Property Summary

NCBI Gene PubMed Count 26
PubMed Score 293.28
PubTator Score 34.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16690 Q12997 Q5T603
Symbols DUSP
HVH3

Gene

PDB

2G6Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (18)

PMID Text
25519881 The DUSP5 S147P protein is hypoactive compared to the DUSP5 wild-type protein.
24651368 Data indicate that cells from Burkitt's lymphoma, leukemia, neuroblastoma and Ewing sarcoma showed a higher dual-specificity phosphatase 5 pseudogene 1 (DUSP5P1)/dual specificity phosphatase 5 (DUSP5 ratio than normal cells.
24308939 DUSP1, DUSP4, and DUSP5 differentially modulate endothelial MAPK signaling pathways downstream of Tie-2 receptors.
23402999 DUSP5 methylation may serve as a prognostic marker for gastric cancer (GC), but this requires validation in a larger set of GC samples.
22812510 Studies indicate that dual-specificity MAP kinase phosphatases (MKPs) DUSP6/MKP-3 and DUSP5 are localized in the cytoplasm and nuclear compartments.
20806045 DUSP5 and DUSP6 selectively control ERK pathway activity and proliferation.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20554528 the differential up-regulation of MKP3 by Ets2 and of DUSP5 by c-Jun may converge in similar functional roles for these MAP kinase phosphatases in the growth arrest versus proliferation decisions of breast cancer cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19801501 In FD-Fms cells, overexpression of human DUSP5 increased M-CSF-dependent proliferation & decreased differentiation. Overexpression in multipotent EGER-Fms cells increased M-CSF-induced proliferation & caused granulocytic, not macrophage, differentiation.
18927432 mutations in dusp-5 and snrk-1 have been identified in affected tissues of patients with vascular anomalies, implicating the Snrk-1-Dusp-5 signaling pathway in human disease.
18430737 proper regulation of DUSP5 activity is critical for normal immune system development, IL-2 actions, and tolerance
17131384 These results suggest the existence of an ERK1/2-driven negative feed-back regulation of ERK5 signaling in epidermal growth factor-stimulated HK-2 cells, which is mediated by MKP-3, DUSP5 and/or MKP-1.
17078075 the crystal structure of the catalytic domain of DUSP5 in an active conformation.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15713638 DUSP5 inactivates ERK2 and causes both nuclear translocation and sequestration of inactive ERK2.
12944906 DUSP5 is a direct target of p53.

AA Sequence

MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEA      1 - 70
ARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECC     71 - 140
VDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLN    141 - 210
VSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMK    211 - 280
TKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQ    281 - 350
GAYCTFPASVLAPVPTHSTVSELSRSPVATATSC                                        351 - 384
//

Text Mined References (27)

PMID Year Title
25519881 2014 Protein expression, characterization and activity comparisons of wild type and mutant DUSP5 proteins.
24651368 2014 Expression of dual-specificity phosphatase 5 pseudogene 1 (DUSP5P1) in tumor cells.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
24308939 2013 Regulation of angiopoietin-1/Tie-2 receptor signaling in endothelial cells by dual-specificity phosphatases 1, 4, and 5.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23402999 2013 Down-regulation of dual-specificity phosphatase 5 in gastric cancer by promoter CpG island hypermethylation and its potential role in carcinogenesis.
22812510 2013 Dual-specificity MAP kinase phosphatases (MKPs): shaping the outcome of MAP kinase signalling.
20806045 2010 DUSP5 and DUSP6 modulate corneal epithelial cell proliferation.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20554528 2010 Differential up-regulation of MAP kinase phosphatases MKP3/DUSP6 and DUSP5 by Ets2 and c-Jun converge in the control of the growth arrest versus proliferation response of MCF-7 breast cancer cells to phorbol ester.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19801501 2010 Macrophage differentiation of myeloid progenitor cells in response to M-CSF is regulated by the dual-specificity phosphatase DUSP5.
18927432 2009 Dusp-5 and Snrk-1 coordinately function during vascular development and disease.
18430737 2008 T-cell development and function are modulated by dual specificity phosphatase DUSP5.
17131384 2007 ERK1/2-driven and MKP-mediated inhibition of EGF-induced ERK5 signaling in human proximal tubular cells.
17078075 2007 Crystal structure of the catalytic domain of human DUSP5, a dual specificity MAP kinase protein phosphatase.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15713638 2005 Specific inactivation and nuclear anchoring of extracellular signal-regulated kinase 2 by the inducible dual-specificity protein phosphatase DUSP5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12944906 2003 Dual-specificity phosphatase 5 (DUSP5) as a direct transcriptional target of tumor suppressor p53.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7961985 1994 A novel dual specificity phosphatase induced by serum stimulation and heat shock.
7836374 1995 Multiple dual specificity protein tyrosine phosphatases are expressed and regulated differentially in liver cell lines.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7806236 1994 Chromosomal localization of four human VH1-like protein-tyrosine phosphatases.