Property Summary

NCBI Gene PubMed Count 46
PubMed Score 262.47
PubTator Score 60.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.386 3.1e-02
active ulcerative colitis 4.095 1.2e-02
acute quadriplegic myopathy 1.221 2.0e-06
adrenocortical adenoma 1.014 4.2e-02
atypical teratoid / rhabdoid tumor 1.800 3.5e-03
Barrett's esophagus 1.700 3.9e-02
Breast cancer -1.500 1.5e-02
colon cancer 1.900 3.3e-02
cystic fibrosis 4.127 7.6e-08
ependymoma -1.800 1.3e-04
esophageal adenocarcinoma 1.800 4.3e-02
facioscapulohumeral dystrophy -1.200 2.3e-02
glioblastoma 1.300 1.7e-02
group 3 medulloblastoma 2.900 2.2e-03
interstitial cystitis -1.100 2.8e-03
invasive ductal carcinoma 1.447 1.3e-02
lung cancer 1.200 3.3e-03
malignant mesothelioma -2.600 1.7e-07
osteosarcoma -2.210 5.6e-03
pancreatic ductal adenocarcinoma liver m... 1.647 2.1e-02
pediatric high grade glioma 1.300 1.7e-02
pituitary cancer -1.400 4.0e-03
psoriasis -1.200 1.4e-02
tuberculosis -4.600 8.2e-08

 GWAS Trait (1)

Gene RIF (33)

AA Sequence

MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCN      1 - 70
TIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDI     71 - 140
CLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYH    141 - 210
AARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHC    211 - 280
QAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPL    281 - 350
RERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC                              351 - 394
//

Text Mined References (51)

PMID Year Title