Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.71
PubTator Score 207.60

Knowledge Summary


No data available


  Differential Expression (16)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.200 1.9e-04
Breast cancer -1.700 7.0e-15
Chronic Lymphocytic Leukemia 1.169 1.7e-02
cystic fibrosis -1.238 1.1e-04
ependymoma -1.100 3.3e-03
hepatocellular carcinoma -1.100 3.0e-02
interstitial cystitis -1.300 1.5e-02
oligodendroglioma -1.100 2.4e-03
ovarian cancer 2.700 9.0e-05
pediatric high grade glioma -1.100 7.4e-04
pituitary cancer -2.200 5.4e-04
primitive neuroectodermal tumor -1.100 1.1e-04
psoriasis 2.400 4.6e-05
ulcerative colitis 1.100 1.9e-03
urothelial carcinoma -1.700 5.0e-02
Waldenstrons macroglobulinemia 1.372 2.6e-02

 GWAS Trait (1)

Gene RIF (18)

AA Sequence

DEAFDFVKQRRGVISPNFSFMGQLLQFETQVLCH                                        281 - 314

Text Mined References (29)

PMID Year Title