Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.47
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 2.1e-02
osteosarcoma -1.331 2.5e-05
intraductal papillary-mucinous neoplasm ... 1.200 9.4e-03

Gene RIF (3)

PMID Text
16720344 DUSP18 appears to serve an important role by regulation of SAPK/JNK pathway
16699184 The crystal structure of human DSP18 (official symbol DUSP18) has been determined at 2.0 A resolution.
12591617 molecular cloning, base sequence and amino acid sequence

AA Sequence

MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVP      1 - 70
VADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPI     71 - 140
IRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL                          141 - 188
//

Text Mined References (10)

PMID Year Title
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
19228121 2009 Dual-specificity phosphatases: critical regulators with diverse cellular targets.
16720344 2006 Dual specificity phosphotase 18, interacting with SAPK, dephosphorylates SAPK and inhibits SAPK/JNK signal pathway in vivo.
16699184 2006 Structure of human DSP18, a member of the dual-specificity protein tyrosine phosphatase family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12591617 2003 Molecular cloning and characterization of a novel dual-specificity phosphatase18 gene from human fetal brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408986 2002 Identification and characterization of two novel low-molecular-weight dual specificity phosphatases.