Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.51
PubTator Score 388.94

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.102 5.1e-06
ependymoma -1.600 3.4e-13
glioblastoma -1.700 2.9e-06
atypical teratoid / rhabdoid tumor -1.400 1.1e-06
medulloblastoma -1.200 3.0e-04
medulloblastoma, large-cell -1.600 3.1e-05
primitive neuroectodermal tumor -1.100 3.5e-03
lung cancer 1.300 3.9e-03
adult high grade glioma -1.900 3.4e-05
pilocytic astrocytoma -1.200 2.4e-05

Gene RIF (2)

PMID Text
20530487 beta-dystrobrevin interacts with the HMG20 proteins iBRAF and BRAF35
16448387 results suggest that dysbindin assembled into BLOC-1 is not a physiological binding partner of the dystrobrevins, likely due to engagement of its dystrobrevin-binding region in interactions with other subunits

AA Sequence

MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTL      1 - 70
DHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMC     71 - 140
GGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFL    141 - 210
DTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPH    211 - 280
SNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHM    281 - 350
SSGVPTPTKRLQYSQDIPSHLADEHALIASYVARLQHCARVLDSPSRLDEEHRLIARYAARLAAEAGNVT    351 - 420
RPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKD    421 - 490
ELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHC    491 - 560
PQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVKELHSAEEGAEEEEEKMQNGKDRG       561 - 627
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22120009 2011 Common variation at 3p22.1 and 7p15.3 influences multiple myeloma risk.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
20530487 2010 The interaction with HMG20a/b proteins suggests a potential role for beta-dystrobrevin in neuronal differentiation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16448387 2006 Reinvestigation of the dysbindin subunit of BLOC-1 (biogenesis of lysosome-related organelles complex-1) as a dystrobrevin-binding protein.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623885 2004 DAMAGE, a novel alpha-dystrobrevin-associated MAGE protein in dystrophin complexes.
14600269 2003 Beta-dystrobrevin interacts directly with kinesin heavy chain in brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11316798 2001 Dysbindin, a novel coiled-coil-containing protein that interacts with the dystrobrevins in muscle and brain.
10747910 2000 Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells.
10545507 1999 Different dystrophin-like complexes are expressed in neurons and glia.
9540997 1998 Identification and characterization of a novel member of the dystrobrevin gene family.
9419360 1998 beta-dystrobrevin, a member of the dystrophin-related protein family.
9395493 1997 beta-dystrobrevin, a new member of the dystrophin family. Identification, cloning, and protein associations.
9146999 1997 Muscular dystrophies and the dystrophin-glycoprotein complex.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.