Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.83
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.1e-07
group 3 medulloblastoma 2254 3.9e-03
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.048 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.600 3.1e-07
group 3 medulloblastoma 1.400 3.9e-03

Gene RIF (1)

PMID Text
18640974 HsMis13 phosphorylation by Aurora B is required for organizing a stable bi-oriented microtubule kinetochore attachment that is essential for faithful chromosome segregation in mitosis.

AA Sequence

MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ      1 - 70
ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS     71 - 140
SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE    141 - 210
MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN    211 - 280
QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS    281 - 350
GSGSCQ                                                                    351 - 356
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23035123 2012 Mitotic regulator SKAP forms a link between kinetochore core complex KMN and dynamic spindle microtubules.
20819937 2010 The MIS12 complex is a protein interaction hub for outer kinetochore assembly.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640974 2008 Phosphorylation of HsMis13 by Aurora B kinase is essential for assembly of functional kinetochore.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18097444 2008 Molecular architecture of the kinetochore-microtubule interface.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981135 2007 Human Blinkin/AF15q14 is required for chromosome alignment and the mitotic checkpoint through direct interaction with Bub1 and BubR1.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16585270 2006 The human Mis12 complex is required for kinetochore assembly and proper chromosome segregation.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.