Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.77
PubTator Score 33.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.500 2.6e-19
atypical teratoid / rhabdoid tumor 1.400 1.0e-03
nasopharyngeal carcinoma -1.800 5.1e-08
chronic rhinosinusitis -1.419 2.3e-02

Gene RIF (1)

PMID Text
23354437 Loss-of-function mutations disrupting DRC1 result in severe defects in assembly of the N-DRC structure and defective ciliary movement in Chlamydomonas reinhardtii and humans

AA Sequence

MNPPGSLEALDPNVDEHLSTQILAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQS      1 - 70
KSYKQKEESRLKLAKLLLCGTELVTNIQVAIDIREIHRRVEEEEIKRQRIEKLENEVKTSQDKFDEITSK     71 - 140
WEEGKQKRIPQELWEMLNTQQLHCAGLLEDKNKLISELQQELKTKDDQYVKDLKKQSDDICLLLERMEEQ    141 - 210
VKNVMKTFREELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWD    211 - 280
CEEYNMIKIKLEQDVQILEQQLQQRKAIYQLNQEKLEYNLQVLKKRDEESTVIKSQQKRKINRLHDILNN    281 - 350
LRSKYAKQIKQFQEENQSLTSDYKRLVMQFKELQKAMRHFALIDDEKFWEIWLMNEEEAKDLIARAFDVD    351 - 420
RIIHTHHLGLPWAAPDFWFLNNVGPISQQPQKSATQIVEEMLMRSEEEEAEEAAAEPESYLDLPKQISEK    421 - 490
TTKRILMLLCDESGFLIESKLLSLLLPLEQNECYLLRLDAIFSALGIESEDDLYKLVNFFLKYRAHRLSS    491 - 560
SLQIKPCSQASMEKASMEETSTRSELELAEQTEMEGEKEESLVEGEKEEEEETPPSPWVIHPNDVLKILE    561 - 630
AFVMGLKKPRDSRAPLRVQKNVRDNSKDSEYWQALTTVIPSSKQNLWDALYTALEKYHLVLTQRAKLLLE    631 - 700
NSSLEQQNTELQALLQQYLNSKINSELQVPPTQVLRVPTK                                  701 - 740
//

Text Mined References (9)

PMID Year Title
25411337 2015 Detailed structural and biochemical characterization of the nexin-dynein regulatory complex.
25186273 2014 Ciliary beat pattern and frequency in genetic variants of primary ciliary dyskinesia.
23354437 2013 The nexin-dynein regulatory complex subunit DRC1 is essential for motile cilia function in algae and humans.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12746204 Absence of nexin links as a possible cause of primary ciliary dyskinesia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.