Property Summary

NCBI Gene PubMed Count 23
PubMed Score 10.65
PubTator Score 14.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Gene RIF (5)

PMID Text
19204005 heterodimerization with NC2alpha masks the nuclear localization signal in NC2beta, which prevents nuclear export of the NC2 complex
17994103 provide evidence that negative cofactor-2 (NC2) induces dynamic conformational changes in the TBP-DNA complex that allow it to escape and return to TATA-binding mode
17548813 The global distribution of DRAP1 on promoters was determined.
15509807 physical cooperation between BTAF1 and NC2alpha in TBP regulation
12477712 Hypoxia actively represses transcription by inducing this protein and blocking preinitiation complex assembly.

AA Sequence

MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHL      1 - 70
KQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQ     71 - 140
EDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS         141 - 205
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19204005 2009 Regulation of nuclear import and export of negative cofactor 2.
17994103 2007 NC2 mobilizes TBP on core promoter TATA boxes.
17548813 2007 Global distribution of negative cofactor 2 subunit-alpha on human promoters.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16484223 2006 FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15509807 2004 NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477712 2003 Hypoxia actively represses transcription by inducing negative cofactor 2 (Dr1/DrAP1) and blocking preinitiation complex assembly.
12471260 2002 Inhibition of excess nodal signaling during mouse gastrulation by the transcriptional corepressor DRAP1.
11461703 2001 Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
10852970 2000 The C-terminal domain-phosphorylated IIO form of RNA polymerase II is associated with the transcription repressor NC2 (Dr1/DRAP1) and is required for transcription activation in human nuclear extracts.
9418848 1998 Involvement of negative cofactor NC2 in active repression by zinc finger-homeodomain transcription factor AREB6.
8972183 1997 Functional dissection of a human Dr1-DRAP1 repressor complex.
8670811 1996 A mechanism for repression of class II gene transcription through specific binding of NC2 to TBP-promoter complexes via heterodimeric histone fold domains.
8608938 1996 Requirement of a corepressor for Dr1-mediated repression of transcription.