Property Summary

NCBI Gene PubMed Count 24
PubMed Score 303.06
PubTator Score 585.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer 1.100 1.8e-03
Waldenstrons macroglobulinemia 1.199 4.6e-02
Multiple myeloma 1.116 9.4e-03
malignant mesothelioma -1.100 2.2e-06
psoriasis 1.900 5.5e-05
osteosarcoma -2.342 6.8e-07
glioblastoma 1.200 2.0e-03
atypical teratoid / rhabdoid tumor -1.300 2.8e-03
medulloblastoma, large-cell 1.200 1.5e-03
intraductal papillary-mucinous adenoma (... 1.600 1.5e-03
intraductal papillary-mucinous carcinoma... 1.800 1.2e-03
lung cancer 1.800 4.4e-03
sarcoidosis 1.200 5.2e-03
Breast cancer 2.600 3.7e-02
cystic fibrosis -1.200 1.7e-05
adult high grade glioma -1.300 7.1e-03
primary Sjogren syndrome 1.200 8.9e-03
pancreatic carcinoma 1.100 1.8e-03
ovarian cancer -1.300 4.2e-05

Gene RIF (10)

PMID Text
25589657 Knockdown of DR1 resulted in reductions of viral RNA and protein production, demonstrating that DR1 acts as a positive host factor in influenza A virus replication.
20534741 Observational study of gene-disease association. (HuGE Navigator)
20230619 Basal core promoters control the equilibrium between negative cofactor 2 and preinitiation complexes in human cells.
19965767 The physiological functions of human Dr1 include regulation of polymerase III transcription.
19204005 heterodimerization with NC2alpha masks the nuclear localization signal in NC2beta, which prevents nuclear export of the NC2 complex
18838386 ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein
18538002 Data show that NC2beta is specifically involved in neuroblastoma pathogenesis and may be considered a new neuroblastoma biomarker.
17584739 the initiator core promoter element antagonizes repression of TATA-directed transcription by negative cofactor NC2
15574413 NC2 controls TBP binding and maintenance on DNA that is largely independent of a canonical TATA sequence
8764062 Interaction of HIV-1 Tat with TBP/TFIID competes with negative cofactor Dr1 interaction with TBP, thereby inhibiting Dr1

AA Sequence

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH      1 - 70
VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE     71 - 140
WLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI                                      141 - 176
//

Text Mined References (32)

PMID Year Title
25589657 2015 A host susceptibility gene, DR1, facilitates influenza A virus replication by suppressing host innate immunity and enhancing viral RNA replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20230619 2010 Basal core promoters control the equilibrium between negative cofactor 2 and preinitiation complexes in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19965767 2010 Dr1 (NC2) is present at tRNA genes and represses their transcription in human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19204005 2009 Regulation of nuclear import and export of negative cofactor 2.
19103755 2009 The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18538002 2008 Involvement of GTA protein NC2beta in neuroblastoma pathogenesis suggests that it physiologically participates in the regulation of cell proliferation.
17584739 2007 The initiator core promoter element antagonizes repression of TATA-directed transcription by negative cofactor NC2.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15574413 2005 Efficient binding of NC2.TATA-binding protein to DNA in the absence of TATA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11461703 2001 Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
9040789 1996 Genomic localization of the human gene encoding Dr1, a negative modulator of transcription of class II and class III genes.
8972183 1997 Functional dissection of a human Dr1-DRAP1 repressor complex.
8884286 1996 Structure and physical mapping of DR1, a TATA-binding protein-associated phosphoprotein gene, to chromosome 1p22.1 and its exclusion in Stargardt disease (STGD).
8836190 1996 Protein-protein interaction between the transcriptional repressor E4BP4 and the TBP-binding protein Dr1.
8764062 1996 Interaction of human immunodeficiency virus type 1 Tat with a unique site of TFIID inhibits negative cofactor Dr1 and stabilizes the TFIID-TFIIA complex.
8670811 1996 A mechanism for repression of class II gene transcription through specific binding of NC2 to TBP-promoter complexes via heterodimeric histone fold domains.
8608938 1996 Requirement of a corepressor for Dr1-mediated repression of transcription.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1339312 1992 Dr1, a TATA-binding protein-associated phosphoprotein and inhibitor of class II gene transcription.