Property Summary

NCBI Gene PubMed Count 23
PubMed Score 106.08
PubTator Score 86.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.7e-03
glioblastoma 1.100 2.4e-02
group 4 medulloblastoma 1.300 2.2e-04
ovarian cancer -1.200 7.8e-07
pituitary cancer 1.300 8.8e-05
primitive neuroectodermal tumor 1.500 6.9e-03

Synonym

Accession Q9BPU6 Q8TCL6 Q9NQC4 Q9NRY9 DRP-5
Symbols CRAM
CRMP5
Ulip6
CRMP-5

Gene

PANTHER Protein Class (2)

PDB

4B90   4B91   4B92  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFH      1 - 70
QTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPK     71 - 140
VKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGI    141 - 210
TGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTG    211 - 280
LHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSG    281 - 350
VQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ    351 - 420
GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRT    421 - 490
PYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS    491 - 560
SGIW                                                                      561 - 564
//

Text Mined References (25)

PMID Year Title