Property Summary

NCBI Gene PubMed Count 188
PubMed Score 374.74
PubTator Score 861.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Malignant tumor of stomach 12
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0
Schizophrenia 503 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.8 2.4
Diarrhea 155 4.01 2.0
Osteoporosis 259 3.673 1.8
Stomatitis 19 3.348 1.7

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -1.900 7.4e-06
glioblastoma 3.000 2.9e-04
osteosarcoma 1.097 1.4e-04
chronic lymphosyte leukemia -1.400 4.6e-06
posterior fossa group A ependymoma 2.100 3.9e-06
cystic fibrosis 3.105 4.1e-07
adrenocortical carcinoma -1.794 5.7e-03
tuberculosis 3.600 2.0e-08
pancreatic ductal adenocarcinoma liver m... -1.198 3.8e-02
non-small cell lung cancer -1.340 2.4e-09
intraductal papillary-mucinous adenoma (... -2.200 4.5e-02
intraductal papillary-mucinous carcinoma... -2.300 1.1e-02
lung cancer -3.300 1.4e-05
colon cancer -1.800 1.5e-02
active Crohn's disease 1.466 1.1e-02
adult high grade glioma 3.000 7.2e-06
atypical teratoid/rhabdoid tumor 1.100 4.2e-02
pilocytic astrocytoma 2.300 3.0e-07
aldosterone-producing adenoma -1.141 2.3e-02
lung carcinoma -1.200 7.9e-15
Breast cancer -2.100 5.2e-10
ulcerative colitis 1.700 2.6e-05
ovarian cancer -5.200 6.3e-09

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (174)

PMID Text
26804235 This study demonstrates the clinical validity of combined MIR27A/DPYD screening to identify patients at risk of severe FP-toxicity.
26658227 Results suggest that DPYD c.1129-5923 C>G/hapB3 have limited predictive value for severe toxicity to 5-FU based combination chemotherapy.
26609109 Study shows that somatic mutations of DPYD cause a switch in pyrimidine metabolism and promote gene expression of pyrimidine enzymes toward malignant progression.
26603945 DPYD variants c.1679T>G and c.1236G>A/HapB3 are clinically relevant predictors of fluoropyrimidine-associated toxicity.
26372896 oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels; bevacizumab induces VEGFA expression in metastatic colorectal cancer
26281864 Demonstrate a correlation between occurrence of DPYD gene variant c.496A>G and KRAS wild type status of colorectal cancer tissue.
26265346 We propose the gene activity score for translating DPYD genotype into phenotype--{REVIEW}
26265035 The relationship between DPD genotype and dihydrouracil/uracil values in the 22 patients of the present study was significant
25906447 The dihydropyrimidine dehydrogenase and ERCC1 expression profile could potentially serve as a useful prognostic biomarker and therapeutic target for surgically resected patients with ampullary carcinoma.
25873402 miR-494 is directly bound to DPYD 3'UTR and negatively regulated DPYD expression in colon cancer.
25782327 Single nucleotide polymorphisms (SNPs) in Dihydropyrimidine Dehydrogenase and UGT1A1 influence fluoropyrimdines and irinotecan adverse events (AEs).
25677447 Germline polymorphism of DPYD have a significant effect on toxicity and clinical outcome in patients receiving capecitabine-based chemotherapy for metastatic gastrointestinal malignancies.
25410891 results suggest that the baseline 5,6-dihydrouracil:uracil plasma ratio in most individuals reflects the nonsaturated state of DPD and is not predictive of decreased DPD activity
25112781 The expression of dihydropyrimidine dehydrogenase and its correlation with survival in stage II/III gastric cancer patients
25066213 genome-wide association studies in women of European ancestry: Data confirm that SNPs in DPYD (rs11587873, rs828054) are associated with ovarian carcinoma; analyses included over 36,000 women contributing DNA in the Ovarian Cancer Assoc Consortium.
24923815 Pre-therapeutic DPYD testing may prevent 20-30% of life-threatening or lethal episodes of fluoropyrimidine toxicity in Caucasian patients
24817302 In patients with heterozygous DPD IVS14+1 mutation, 5-FU dose should be appropriately reduced according to last plasma concentration to reduce adverse reactions, while the homozygous ones should avoid application of 5-FU and its derivatives.
24800948 Colorectal tumors, deficient in mismatch repair, overexpress thymidylate synthetase and dihydropyrimidine dehydrogenase.
24648345 Association between flurouracil toxicity and DPYD missense mutations.
24647007 DPYD harbours rare and common capecitabine toxicity variants
24590654 Of 36 previously assessed polymorphisms, only four-TYMS 5'VNTR 2R/3R, TYMS 3'UTR 6bpins-del, DPYD 2846TA, and DPYD *2A-were formally associated with global G3+ toxicity in our analysis. Associations were only present in fluorouracil monotherapy regimens.
24455740 We suggest that a chip including DPYD, TYMS, TYMP, TK1, and TK2 genes is a potential tool to predict response in LARC following fluoropyrimidine-based CCRT.
24405586 High expression of dihydropyrimidine dehydrogenase in lung adenocarcinoma is associated with mutations in epidermal growth factor receptor and response to chemotherapy.
24401318 Taken together, these results suggest that miR-27a and miR-27b expression may be pharmacologically relevant modulators of Dihydropyrimidine dehydrogenase enzyme function in the liver.
24104963 In TNBC, we detected 43 (41%) tumour specimens with genomic deletions and/or duplications within DPYD.
23960437 One nonsynonymous SNP of Dihydropyrimidine dehydrogenase (+199381A > G, Asn151Asp) was predicted to change its polarity of amino acid (Asn, neutral to Asp, negative).
23942539 DPYD*5 and 1896 T>C accounted for 29.9% of the occurrences of neutropenia (analysis of variance, P = 0.017).
23930673 The results of this meta-analysis confirm clinical validity of DPYD IVS14+1G>A and 2846A>T as risk factors for the development of severe toxicities following fluoropyrimidine treatment.
23781135 data clearly indicated that the T464A and homozygous of the T85C of dihydropyrimidine dehydrogenase are stronger biomarkers to predict the 5-FU toxicity
23736036 Variation in the DPYD, TYMS, CDA and MTHFR genes are clinically significant predictors of fluoropyrimidine toxicity.
23603345 Mutated DPYD is frequently observed in Caucasian patients who experience toxicities while receiving 5-FU/capecitabine.
23597150 DPD is involved in the survival of human embryo brain-derived cells in culture. There was a a reversed correlation between the activities of XO and DPD over 12 days under normal conditions as well as in the presence of XO and DPD inhibitors.
23588312 A DPYD variant (Y186C) in individuals of african ancestry is associated with reduced DPD enzyme activity.
23401991 More than 30 mutations of DPYD gene have been identified in patients with cancer. A large number of them limits introduction of simple genetic test, which could be used for detection of DPD deficiency.
23313143 Data suggest that upregulation of dihydropyrimidine dehydrogenase (DPD) in liver may be involved in acquired resistance to 5-fluorouracil (5-FU), and DPD inhibitors or increasing 5-FU dosage may overcome 5-FU acquired resistance.
22641663 The organs in which metastases of colorectal cancer arise may be controlled by the expression of dihydropyrimidine dehydrogenase.
22593457 mRNA expression of TYMS, DPYD, and TYMP is associated with distinct characteristics and may be useful for predicting survival in patients with stage IV colorectal cancer.
22510597 The radiosensitizing effect of DPYD depletion plus CPT was the additive effect of DPYD depletion and CPT.
22490566 Results suggest that polymorphisms of rs1801159 in DPYD may be used as valuable predictors of the response to fluorouracil-based chemotherapy for gastric cancer patients in the Chinese population.
22339448 Profound differences in the elimination of 5-fluorouracil could be detected between DPYD-deficient patients and control patients.
22306127 DPYD gene expression is regulated by miR-27a, miR-27b, miR-134, and miR-582-5p.
22270332 No clear correlation was observed between the dihydropyrimidine dehydrogenase mRNA expression and any clinicopathological variable in gallbladder carcinoma.
22199347 dihydropyrimidine dehydrogenase has a role in prolonged survival in patients with lung adenocarcinoma treated with 5-fluorouracil
22143355 Low DPD mRNA expression was related to macroscopic type and associated with poor prognosis. DPD mRNA expression in tumor cells is suggested to be an important regulator of malignant behavior in IHCC.
22006578 High TS and DPD mRNA levels on FFPE specimens may predict distant recurrence of rectal cancer treated with 5-FU-based preoperative CRT followed by surgery.
22003227 Hemizygous deletions of the dihydropyrimidine dehydrogenase (DPYD) locus contribute to intellectual disability phenotypes.
21965773 This study investigated the expression of TS and DPD in cervical lymph node metastases and its relationship with primary oral squamous cell carcinoma, as well as the interaction between these enzymes and Kangai 1(KAI1/CD82).
21919605 Specific combinations of functional polymorphisms in DPYD and TYMS were demonstrated to be associated with DFS and overall survival in patients receiving adjuvant 5-FU-based treatment
21612699 The expression level of DPD was correlated to differentiation levels of pancreatic cancer and TNM staging.
21498394 DPYD IVS14+1G>A and 2846A>T predict for severe toxicity to capecitabine, for which patients require dose reductions.
21114665 We describe the identification and clinical presentation of 4 individuals from 3 unrelated families with hemizygous deletions involving the DPYD gene at chromosome 1p21.3. All met diagnostic criteria for aautism spectrum disorder with severe speech delay.
21111509 Tumor expression levels of thymidylate synthetase and dihydropyrimidine dehydrogenase are predictive of response to S-1-carboplatin chemotherapy in patients with advanced non-small cell lung cancer
21057378 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20837458 Thymidylate synthase, thymidine phosphorylase, and dihydropyrimidine dehydrogenase play a role in the prognosis of non-small-cell lung cancer.
20819423 Variants in the dihydropyrimidine dehydrogenase, methylenetetrahydrofolate reductase and thymidylate synthase genes predict early toxicity of 5-fluorouracil in colorectal cancer patients.
20819423 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20809970 Promoter methylation and large intragenic rearrangements of DPYD are not implicated in severe toxicity to 5-fluorouracil-based chemotherapy in gastrointestinal cancer.
20803296 Genomic deletion affecting DPYD and a deep intronic mutation affecting pre-mRNA splicing can cause severe 5FU-associated toxicity.
20714877 TYMP and TYMS mRNA and protein expression levels were significantly higher in epithelial ovarian cancer, and DPYD mRNA and protein expression levels were significantly lower.
20714149 Observational study of gene-disease association. (HuGE Navigator)
20665215 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20653680 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20647710 OPRT/dihydropyrimidine dehydrogenase ratio has a relation to cancer staging and survival rate.
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20570913 Observational study of gene-disease association. (HuGE Navigator)
20544545 Dihydropyrimidine dehydrogenase deficiency was caused by a novel genomic deletion c.505_513del of DPYD.
20530282 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20507294 An objective behind the study was to ascertain existence of the IVS14 + 1G A DPYD mutation among the population of Bosnia and Herzegovina
20507294 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20407238 The DPD level was significantly lower in colonic tumors than in rectal tumors; DPD levels in women were significantly lower than that in men
20385995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20157331 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20037211 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19858398 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19822137 Data report two new DPYD gene variants, of which DPYD c.1796T>C is potentially pathogenic, whereas DPYD IVS14+17A>G is suggested as a variant without clinical significance.
19795123 genetic DPD deficiency accounts for around 19% of cases of severe fluoropyrimidine toxicity.
19724871 patients who developed distant recurrence of rectal cancer were found to have significantly higher intratumoral thymidylate synthase (TS), dihydropyrimidine dehydrogenase (DPD) and orotate phosphoribosyl transferase (OPRT)
19636001 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19571608 compared patient survivals between groups, taking TS and DPD cutoff as median values, high versus low DPD and high versus low TS in the cancerous tissue of pancreatic and biliary tract cancers
19546880 Observational study of genotype prevalence. (HuGE Navigator)
19530960 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19473056 dihydropyrimidine dehydrogenase gene coding sequence variants is associated with the development of fluoropyrimidine-related toxicity in colorectal cancer.
19473056 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19296131 Genomic deletions affect DPYD in 7% of all DPD deficient patients.
19296131 Observational study of gene-disease association. (HuGE Navigator)
19295264 recurrence-free survival time curve showed significant differences when stratified by tumor diameter, ER expression, and TS levels, but not by menopausal status, nodal status, surgical method, p53 expression, DPD activity, or HER2 expression
19288105 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19178088 Frequency of the 735G --> A mutation of the 5'-splice donor site of intron 14 of the dihydropyrimidine dehydrogenase gene (DPYD) in residents of Novosibirsk region (Russia)
19178088 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
19154585 Microsatellite instability was correlated with TS gene expression but not significantly with DPD.
19104657 At least in distinct tumor types, a common DPYD polymorphism strongly contributes to the occurrence of fluoropyrimidine-related drug adverse effects.
19104657 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19020767 head & neck, gastric, colorectal, breast, lung & pancreatic cancer were examined; findings show mRNA expression & protein level of thymidylate synthase, dihydropyrimidine dehydrogenase & orotate phosphoribosyltransferase differed according to cancer type
18937829 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18705276 The level of Dihydropyrimidine dehydrogenase mRNA may be affected by the clinicopathological status of patients with cirrhosis.
18619742 High performance liquid chromatography may be used to screen for DPD deficiency in cancer patients before being treated with 5-fluorouracil.
18537153 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18452418 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18443386 Observational study of gene-disease association. (HuGE Navigator)
18347391 pyrimidine nucleoside phosphorylase/dihydropyrimidine dehydrogenase ratio may be a new prognostic marker in breast cancer
18299612 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18225548 Observational study of gene-disease association. (HuGE Navigator)
18225548 The IVS14+1G > A mutation (heterozygous) in the DPYD gene was identified in two healthy subjects in this Turkish population.
18004243 dihydropyrimidine dehydrogenase is a promising molecular maker for identifying tumor cells sensitivity in breast cancer patients receiving FU-based chemotherapy
17905396 Observational study of genotype prevalence. (HuGE Navigator)
17905396 12 variants in the DPYD coding region & a new intronic polymorphism IVS 6-29 G>T were detected.
17876700 Observational study of genetic testing. (HuGE Navigator)
17848752 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17848752 study demonstrated relationship between DPYD gene polymorphism among 75 gastric & colon carcinoma patients & its impact on 5-FU pharmacokinetic & side effects; DPYD*5 gene mutation contributes to reduced DPYD enzyme activity & 5-FU dysmetabolism
17828463 Observational study of genotype prevalence. (HuGE Navigator)
17828463 Nine novel nonsynonymous DPYD SNPs were found in Japanese associated with a risk for developing a severe or fatal toxicity to 5-FU.
17699798 Results revealed a disturbed transcription of Per1 during tumor progression, which might be the cause for disrupted daily oscillation of DPD in undifferentiated colon carcinoma cells.
17612628 active transcription machinery for DPYD is present in RKO colorectal cancer cells, but promoter binding of Sp1, a transactivator of DPYD, was inhibited, which on subsequent examination was shown to be associated with dense promoter methylation
17582310 Assays to detect DPD deficiency should be but are not used as a screening test to prevent 5-FU toxicity in cancer treatment.
17582309 Detection of DPD deficiency would avoid almost every early acute toxic side-effects of fluropyrimidnine treatment.
17445431 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17445431 DPYD*5 gene mutation contributes to reduced DPYD enzyme activity and 5-FU metabolism, which is associated with accumulation of 5-FU and chemotherapeutic toxicity in patients with gastric and colonic carcinoma
17417073 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17417073 findings, from Korean patients with colon cancer, suggest that polymorphisms of the DPYD gene are not associated with an increased risk for toxic response to 5-fluorouracil
17397246 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17377791 Gene expression may be a response to fluorouracil sensitivity in stomach cancers of different histologic origin.
17375478 Observational study of gene-disease association. (HuGE Navigator)
17375478 study suggested that the influence of DPYD T85C posed only a limited risk for the six malignancies - esophageal, gastric, colon, lung, breast, and malignant lymphomas
17335544 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17203168 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17203168 thymidylate synthase and dihydropyrimidine dehydrogenase gene polymorphisms have a role in response and toxicity to capecitabine-raltitrexed treatment in colorectal cancer
17165084 The mutation IVS14 + 1 G > A, DPYD*2A, is the most common mutation associated with DPD deficiency
17121937 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17046731 A novel mutation 464 T>A was identified in DPYD gene exon 5, resulting in the replacement of leucine 155 by a stop codon in the protein.
17000685 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16969493 thymidine phosphorylase levels are more elevated relative to dihydropyrimidine dehydrogenase levels in squamous cell carcinoma than in adenocarcinoma
16820886 DPD gene silencing is caused by epigenetic modification in biliary tract cancer cellsand has a role in sensitivity to 5-FU treatment
16806531 Sp1 is a strong activator, while Sp3 by its own is a weak activator of the DPYD promoter.
16786143 DPD may have a role in progression of colorectal cancer
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16361556 Methylation of the DPYD promoter region is associated with down-regulation of DPD activity in clinical samples and should be considered as a potentially important regulatory mechanism of DPD activity and basis for 5-FU toxicity in cancer patients.
16328315 Observational study of genotype prevalence. (HuGE Navigator)
16132996 Association of mRNA expresion patterns with tumor stage and suggested new prognostic and predictive markers for patients with colorectal cancer.
16021908 a newly described polymorphism of DPD gene might affect transcription of DPD and influence response to 5-FU
15999119 thymidylate synthase and orotate phosphoribosyl transferase, but not dihydropyrimidine dehydrogenase, are more highly expressed in prostate cancer than in benign prostatic hyperplasia
15993511 thymidylate synthase and dihydropyrimidine dehydrogenase are involved in resistance to 5-fluorouracil in human lung cancer cells
15939134 This rate limiting enzyme of 5-fluorouracil whose activity in mononuclear cells shows circadian variation.
15709212 Specific genetic polymorphisms in drug metabolizing enzymes (e.g., TPMT, UGT1A1, DPD), drug transporters (MDR1), and drug target enzymes (TS) are associated with clinical outcomes in patients treated with 5-fluorouracil and irinotecan.
15316940 DPD in differentiated type malignant tissue was statistically lower than in normal stromal tissue (p < 0.001), but no difference was seen in undifferentiated type cases.
15254700 Thymidine phosphorylase and dihydropyrimidine dehydrogenase have roles in progression of liver metastasis
15132136 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15102667 Observational study of genetic testing. (HuGE Navigator)
15069545 In stages I and II, DPD levels in the tumor specimens tended to be higher in the gastric cancer group than in the colorectal cancer group
15025795 Observational study of gene-environment interaction. (HuGE Navigator)
15017333 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14702180 There is no prognostic significance to DHP mRNA expression in breast neoplasms.
14654904 DPD expression may function as a marker of DPD activity and may be a prognostic indicator for patients with breast cancer.
14562021 high orotate phosphoribosyltransferase/dihydropyrimidine dehydrogenase ratio associated with longer survival in colorectal cancer patients treated with fluoropyrimidine-based chemotherapy
14519634 TS and DPD quantitation may be helpful to evaluate prognosis of patients receiving adjuvant 5-FU and that patients with high TS and low DPD may benefit from adjuvant 5-FU chemotherapy in colorectal cancer.
12851836 The DPYD mutation associated with lack of DPD activity, warrants genetic screening of these mutation before administration 5-FU for cancer patients.
12844478 A deficiency or mutation in this gene in patients with epithelial neoplasms might be the cause of toxicity when administered 5-FU.
12822071 Observational study of genetic testing. (HuGE Navigator)
12576451 Gene expression is a predictor for the efficacy of fluoropyrimidine-based chemotherapy for metastatic colorectal cancer.
12360106 Observational study of gene-environment interaction. (HuGE Navigator)
12360106 High prevalence of the IVS14 + 1G>A mutation is found in the gene of patients with severe 5-FU-associated toxicity.
12209976 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12047484 Observational study of genotype prevalence. (HuGE Navigator)
12025228 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11992400 TK1 gene expression together with TS, TP and DPD gene expression may play important roles in influencing the malignant behavior of epithelial ovarian cancer.
11988088 Novel disease-causing mutations in the dihydropyrimidine dehydrogenase gene interpreted by analysis of the three-dimensional protein structure
11895907 DPD deficiency resulting from a compound heterozygote is seen in proband of breast cancer patients
11862480 circadian expression seen in leukocytes of healthy subjects, but rhythm disturbed in patients with advanced gastrointestinal carcinomas
11555601 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11267945 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGER      1 - 70
GALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGC     71 - 140
NLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLG    141 - 210
YSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAF    211 - 280
IGIGLPEPNKDAIFQGLTQDQGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATS    281 - 350
ALRCGARRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN    351 - 420
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGGDVVGLANTTV    421 - 490
ESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGLKFINPFGLASATPATSTSMI    491 - 560
RRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMYGPGQSSFLNIELISEKTAAYWCQSVTELKA    561 - 630
DFPDNIVIASIMCSYNKNDWTELAKKSEDSGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQ    631 - 700
AVQIPFFAKLTPNVTDIVSIARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAI    701 - 770
RPIALRAVTSIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL    771 - 840
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQNVAFSPLKRN    841 - 910
CFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLP    911 - 980
TITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLSVNPVC                             981 - 1025
//

Text Mined References (198)

PMID Year Title
26804235 2016 Rs895819 in MIR27A improves the predictive value of DPYD variants to identify patients at risk of severe fluoropyrimidine-associated toxicity.
26658227 2016 Association between DPYD c.1129-5923 C>G/hapB3 and severe toxicity to 5-fluorouracil-based chemotherapy in stage III colon cancer patients: NCCTG N0147 (Alliance).
26609109 2016 Hypermutation of DPYD Deregulates Pyrimidine Metabolism and Promotes Malignant Progression.
26603945 2015 Clinical relevance of DPYD variants c.1679T>G, c.1236G>A/HapB3, and c.1601G>A as predictors of severe fluoropyrimidine-associated toxicity: a systematic review and meta-analysis of individual patient data.
26372896 2015 Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study.
26281864 2016 Correlation between DPYD gene variation and KRAS wild type status in colorectal cancer.
26265346 2015 Translating DPYD genotype into DPD phenotype: using the DPYD gene activity score.
26265035 2016 Genotyping of a family with a novel deleterious DPYD mutation supports the pretherapeutic screening of DPD deficiency with dihydrouracil/uracil ratio.
25906447 2015 Prognostic Value of Excision Repair Cross-Complementing Gene 1, Dihydropyrimidine Dehydrogenase, and Human Equilibrative Nucleotide Transporter 1 Expression and Their Implications for Adjuvant Treatment in Patients With Ampullary Carcinoma.
25873402 2015 MicroRNA-494 sensitizes colon cancer cells to fluorouracil through regulation of DPYD.
25782327 2015 DPD and UGT1A1 deficiency in colorectal cancer patients receiving triplet chemotherapy with fluoropyrimidines, oxaliplatin and irinotecan.
25677447 2015 Germline TYMS genotype is highly predictive in patients with metastatic gastrointestinal malignancies receiving capecitabine-based chemotherapy.
25416956 2014 A proteome-scale map of the human interactome network.
25410891 2014 Predicting 5-fluorouracil toxicity: DPD genotype and 5,6-dihydrouracil:uracil ratio.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25112781 2015 Impact of the expression of thymidylate synthase and dihydropyrimidine dehydrogenase genes on survival in stage II/III gastric cancer.
25066213 2014 Consortium analysis of gene and gene-folate interactions in purine and pyrimidine metabolism pathways with ovarian carcinoma risk.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24923815 2015 Clinical importance of risk variants in the dihydropyrimidine dehydrogenase gene for the prediction of early-onset fluoropyrimidine toxicity.
24817302 2014 The role of IVS14+1 G > A genotype detection in the dihydropyrimidine dehydrogenase gene and pharmacokinetic monitoring of 5-fluorouracil in the individualized adjustment of 5-fluorouracil for patients with local advanced and metastatic colorectal cancer: a preliminary report.
24800948 2014 Molecular patterns in deficient mismatch repair colorectal tumours: results from a French prospective multicentric biological and genetic study.
24648345 2014 Comparative functional analysis of DPYD variants of potential clinical relevance to dihydropyrimidine dehydrogenase activity.
24647007 2015 A candidate gene study of capecitabine-related toxicity in colorectal cancer identifies new toxicity variants at DPYD and a putative role for ENOSF1 rather than TYMS.
24590654 2014 Genetic markers of toxicity from capecitabine and other fluorouracil-based regimens: investigation in the QUASAR2 study, systematic review, and meta-analysis.
24455740 2013 DPYD, TYMS, TYMP, TK1, and TK2 genetic expressions as response markers in locally advanced rectal cancer patients treated with fluoropyrimidine-based chemoradiotherapy.
24405586 2014 High expression of dihydropyrimidine dehydrogenase in lung adenocarcinoma is associated with mutations in epidermal growth factor receptor: implications for the treatment of non--small-cell lung cancer using 5-fluorouracil.
24401318 2014 microRNAs miR-27a and miR-27b directly regulate liver dihydropyrimidine dehydrogenase expression through two conserved binding sites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24104963 2013 Somatic copy number changes in DPYD are associated with lower risk of recurrence in triple-negative breast cancers.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23960437 2013 Screening of dihydropyrimidine dehydrogenase genetic variants by direct sequencing in different ethnic groups.
23942539 2013 Potential of dihydropyrimidine dehydrogenase genotypes in personalizing 5-fluorouracil therapy among colorectal cancer patients.
23930673 2013 DPYD IVS14+1G>A and 2846A>T genotyping for the prediction of severe fluoropyrimidine-related toxicity: a meta-analysis.
23781135 2013 Evaluation of clinical value of single nucleotide polymorphisms of dihydropyrimidine dehydrogenase gene to predict 5-fluorouracil toxicity in 60 colorectal cancer patients in China.
23736036 2013 Pharmacogenetic variants in the DPYD, TYMS, CDA and MTHFR genes are clinically significant predictors of fluoropyrimidine toxicity.
23603345 Dihydropyrimidine dehydrogenase gene (DPYD) polymorphism among Caucasian and non-Caucasian patients with 5-FU- and capecitabine-related toxicity using full sequencing of DPYD.
23597150 2013 Dependence of cell survival on correlative activities of xanthine oxidase and dihydopyrimidine dehydrogenase in human brain-derived cell culture.
23588312 2013 A DPYD variant (Y186C) in individuals of african ancestry is associated with reduced DPD enzyme activity.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23401991 2012 [Review of methods for determination of dihydropyrimidine dehydrogenase and possible application in screening previous chemotheraphy with 5-fluorouracil].
23313143 2013 The upregulation of dihydropyrimidine dehydrogenase in liver is involved in acquired resistance to 5-fluorouracil.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22641663 2012 Expression of dihydropyrimidine dehydrogenase, orotate phosphoribosyl transferase and thymidylate synthase in patients with primary colorectal cancer, and associations with site of first metastasis.
22593457 2012 Expression levels of thymidylate synthase, dihydropyrimidine dehydrogenase, and thymidine phosphorylase in patients with colorectal cancer.
22510597 2012 Effects of depletion of dihydropyrimidine dehydrogenase on focus formation and RPA phosphorylation.
22490566 2012 Polymorphisms of dihydropyrimidine dehydrogenase gene and clinical outcomes of gastric cancer patients treated with fluorouracil-based adjuvant chemotherapy in Chinese population.
22339448 2012 Evaluation of 5-fluorouracil pharmacokinetics in cancer patients with a c.1905+1G>A mutation in DPYD by means of a Bayesian limited sampling strategy.
22306127 2012 Dihydropyrimidine dehydrogenase (DPD) expression is negatively regulated by certain microRNAs in human lung tissues.
22270332 2012 Role of thymidylate synthase and dihydropyrimidine dehydrogenase mRNA expressions in gallbladder carcinoma.
22199347 2011 Low dihydropyrimidine dehydrogenase correlates with prolonged survival in patients with lung adenocarcinoma treated with 5-fluorouracil.
22143355 2012 Role of thymidylate synthase and dihydropyrimidine dehydrogenase mRNA in intrahepatic cholangiocarcinoma.
22006578 2012 TS and DPD mRNA levels on formalin-fixed paraffin-embedded specimens as predictors for distant recurrence of rectal cancer treated with preoperative chemoradiotherapy.
22003227 2011 Chromosome 1p21.3 microdeletions comprising DPYD and MIR137 are associated with intellectual disability.
21965773 2011 Expression of thymidylate synthase and dihydropyrimidine dehydrogenase in primary oral squamous cell carcinoma and corresponding metastases in cervical lymph nodes: association with the metastasis suppressor CD82.
21919605 2011 The association of polymorphisms in 5-fluorouracil metabolism genes with outcome in adjuvant treatment of colorectal cancer.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21612699 2011 [Expression of dihydropyrimidine dehydrogenase negatively correlated with the prognosis of pancreatic ductal adenocarcinoma].
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21498394 2011 Relationship between single nucleotide polymorphisms and haplotypes in DPYD and toxicity and efficacy of capecitabine in advanced colorectal cancer.
21114665 2011 Hemizygous deletions on chromosome 1p21.3 involving the DPYD gene in individuals with autism spectrum disorder.
21111509 2011 Thymidylate synthase and dihydropyrimidine dehydrogenase expression levels are associated with response to S-1 plus carboplatin in advanced non-small cell lung cancer.
21057378 2011 Multiple genetic polymorphisms in the prediction of clinical outcome of metastatic colorectal cancer patients treated with first-line FOLFOX-4 chemotherapy.
20837458 2010 Low thymidylate synthase, thymidine phosphorylase, and dihydropyrimidine dehydrogenase mRNA expression correlate with prolonged survival in resected non-small-cell lung cancer.
20819423 Variants in the dihydropyrimidine dehydrogenase, methylenetetrahydrofolate reductase and thymidylate synthase genes predict early toxicity of 5-fluorouracil in colorectal cancer patients.
20809970 2010 Promoter methylation and large intragenic rearrangements of DPYD are not implicated in severe toxicity to 5-fluorouracil-based chemotherapy in gastrointestinal cancer patients.
20803296 2010 Intragenic deletions and a deep intronic mutation affecting pre-mRNA splicing in the dihydropyrimidine dehydrogenase gene as novel mechanisms causing 5-fluorouracil toxicity.
20714877 2010 Relationship between the expression of thymidylate synthase, thymidine phosphorylase and dihydropyrimidine dehydrogenase and survival in epithelial ovarian cancer.
20714149 2010 Genetic polymorphisms associated with 5-Fluorouracil-induced neurotoxicity.
20665215 2010 Value of gene polymorphisms as markers of 5-FU therapy response in stage III colon carcinoma: a pilot study.
20653680 2010 Absence of large intragenic rearrangements in the DPYD gene in a large cohort of colorectal cancer patients treated with 5-FU-based chemotherapy.
20647710 2010 [Correlation between clinicopathological factors and enzymatic activity of orotate phosphoribosyl transferase (OPRT), dihydropyrimidine dehydrogenase (DPD) in esophageal cancer].
20647221 2011 Associations of various gene polymorphisms with toxicity in colorectal cancer patients receiving oral uracil and tegafur plus leucovorin: a prospective study.
20570913 2010 Genetic variation in TYMS in the one-carbon transfer pathway is associated with ovarian carcinoma types in the Ovarian Cancer Association Consortium.
20544545 2010 Dihydropyrimidine dehydrogenase deficiency caused by a novel genomic deletion c.505_513del of DPYD.
20530282 2010 Pharmacogenetic predictors of adverse events and response to chemotherapy in metastatic colorectal cancer: results from North American Gastrointestinal Intergroup Trial N9741.
20507294 2010 Investigation of IVS14 + 1G > A polymorphism of DPYD gene in a group of Bosnian patients treated with 5-Fluorouracil and capecitabine.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20407238 2010 Correlations of clinicopathological factors with protein expression levels of thymidylate synthase, dihydropyrimidine dehydrogenase and orotate phosphoribosyltransferase in colorectal cancer.
20385995 2010 Pharmacogenetic assessment of toxicity and outcome in patients with metastatic colorectal cancer treated with LV5FU2, FOLFOX, and FOLFIRI: FFCD 2000-05.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20157331 2010 SNPs in genes coding for ROS metabolism and signalling in association with docetaxel clearance.
20037211 2009 TPMT and DPD polymorphisms: Efficient screening method for Indian patients considering taking Thiopurine and 5-FU drugs.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19858398 2009 Association of molecular markers with toxicity outcomes in a randomized trial of chemotherapy for advanced colorectal cancer: the FOCUS trial.
19822137 2010 Two cases of 5-fluorouracil toxicity linked with gene variants in the DPYD gene.
19795123 2010 The contribution of deleterious DPYD gene sequence variants to fluoropyrimidine toxicity in British cancer patients.
19724871 2009 Microdissection is essential for gene expression analysis of irradiated rectal cancer tissues.
19636001 2009 Racial differences in advanced colorectal cancer outcomes and pharmacogenetics: a subgroup analysis of a large randomized clinical trial.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19571608 2009 Thymidylate synthase and dihydropyrimidine dehydrogenase are upregulated in pancreatic and biliary tract cancers.
19546880 2009 Influence of ethnicity on pharmacogenetic variation in the Ghanaian population.
19530960 2009 Dihydropyrimidine dehydrogenase gene variation and severe 5-fluorouracil toxicity: a haplotype assessment.
19473056 2009 Influence of dihydropyrimidine dehydrogenase gene (DPYD) coding sequence variants on the development of fluoropyrimidine-related toxicity in patients with high-grade toxicity and patients with excellent tolerance of fluoropyrimidine-based chemotherapy.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19296131 2009 Analysis of severely affected patients with dihydropyrimidine dehydrogenase deficiency reveals large intragenic rearrangements of DPYD and a de novo interstitial deletion del(1)(p13.3p21.3).
19295264 2009 [Clinical significance of intratumoral TS levels and DPD activity in breast cancer].
19288105 2009 Lack of large intragenic rearrangements in dihydropyrimidine dehydrogenase (DPYD) gene in fluoropyrimidine-treated patients with high-grade toxicity.
19178088 2008 [Frequency of the 735G --> A mutation of the 5'-splice donor site of intron 14 of the dihydropyrimidine dehydrogenase gene (DPYD) in residents of Novosibirsk region (Russia) as revealed with fluorescent oligonucleotides].
19154585 2009 Microsatellite instability in colorectal cancer and association with thymidylate synthase and dihydropyrimidine dehydrogenase expression.
19104657 2008 Strong association of a common dihydropyrimidine dehydrogenase gene polymorphism with fluoropyrimidine-related toxicity in cancer patients.
19020767 2008 Thymidylate synthase, dihydropyrimidine dehydrogenase, orotate phosphoribosyltransferase mRNA and protein expression levels in solid tumors in large scale population analysis.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18937829 2008 Hypermethylation of the DPYD promoter region is not a major predictor of severe toxicity in 5-fluorouracil based chemotherapy.
18705276 Quantitative analysis of fluorouracil-related genes in chronic viral hepatitis using microdissection.
18619742 2009 The dihydrouracil/uracil ratio in plasma, clinical and genetic analysis for screening of dihydropyrimidine dehydrogenase deficiency in colorectal cancer patients treated with 5-fluorouracil.
18537153 2008 Dihydropyrimidine dehydrogenases and cytidine-deaminase gene polymorphisms as outcome predictors in resected gastric cancer patients treated with fluoropyrimidine adjuvant chemotherapy.
18452418 2008 Analysis of the DPYD gene implicated in 5-fluorouracil catabolism in Chinese cancer patients.
18443386 5-Fluorouracil toxicity-attributable IVS14 + 1G > A mutation of the dihydropyrimidine dehydrogenase gene in Polish colorectal cancer patients.
18347391 2008 [Significance of pyrimidine nucleoside phosphorylase and dihydropyrimidine dehydrogenase levels to predict postoperative recurrence in primary breast cancer].
18299612 2008 Role of genetic and nongenetic factors for fluorouracil treatment-related severe toxicity: a prospective clinical trial by the German 5-FU Toxicity Study Group.
18225548 Investigation of IVS14+ 1G > A polymorphism of DPYD gene in a group of Turkish patients with colorectal cancer.
18075467 2007 Genetic regulation of dihydropyrimidinase and its possible implication in altered uracil catabolism.
18004243 2007 Dihydropyrimidine dehydrogenase activity correlates with fluorouracil sensitivity in breast cancer.
17905396 2007 Mutational spectrum of dihydropyrimidine dehydrogenase gene (DPYD) in the Tunisian population.
17876700 2007 SSCP screening of the dihydropyrimidine dehydrogenase gene polymorphisms of the Japanese population using a semi-automated electrophoresis unit.
17848752 2007 DPYD*5 gene mutation contributes to the reduced DPYD enzyme activity and chemotherapeutic toxicity of 5-FU: results from genotyping study on 75 gastric carcinoma and colon carcinoma patients.
17828463 2007 Genetic variations and haplotype structures of the DPYD gene encoding dihydropyrimidine dehydrogenase in Japanese and their ethnic differences.
17699798 2007 Regulation of genes of the circadian clock in human colon cancer: reduced period-1 and dihydropyrimidine dehydrogenase transcription correlates in high-grade tumors.
17612628 2007 Suppression of DPYD expression in RKO cells via DNA methylation in the regulatory region of the DPYD promoter: a potentially important epigenetic mechanism regulating DPYD expression.
17582310 [Pro or con the phenotyping/genotyping of patients treated by 5-Fluorouracil to prevent adverse drug reactions?].
17582309 [Detection of dihydropyrimidine dehydrogenase deficiency before treatment by fluoropyrimidines].
17445431 2007 [The association between DPYD gene polymorphism and chemotherapeutic toxicity of 5-FU in gastric carcinoma and colonic carcinoma].
17417073 2007 Thymidylate synthase (TYMS) and dihydropyrimidine dehydrogenase (DPYD) polymorphisms in the Korean population for prediction of 5-fluorouracil-associated toxicity.
17397246 2007 Rapid detection of the DPYD IVS14+1G>A mutation for screening patients to prevent fluorouracil-related toxicity.
17377791 2007 Correlation between thymidylate synthase and dihydropyrimidine dehydrogenase mRNA level and in vitro chemosensitivity to 5-fluorouracil, in relation to differentiation in gastric cancer.
17375478 2005 Polymorphism of dihydropyrimidine dehydrogenase (DPYD) Cys29Arg and risk of six malignancies in Japanese.
17335544 2007 Dihydropyrimidine dehydrogenase activity and the IVS14+1G>A mutation in patients developing 5FU-related toxicity.
17203168 2007 Polymorphisms in the thymidylate synthase and dihydropyrimidine dehydrogenase genes predict response and toxicity to capecitabine-raltitrexed in colorectal cancer.
17165084 2007 DPYD*2A mutation: the most common mutation associated with DPD deficiency.
17121937 2006 Clinical relevance of different dihydropyrimidine dehydrogenase gene single nucleotide polymorphisms on 5-fluorouracil tolerance.
17046731 2007 Identification of a novel mutation in the dihydropyrimidine dehydrogenase gene in a patient with a lethal outcome following 5-fluorouracil administration and the determination of its frequency in a population of 500 patients with colorectal carcinoma.
17000685 2006 Pharmacogenetics of capecitabine in advanced breast cancer patients.
16969493 2006 Thymidine phosphorylase levels and dihydropyrimidine dehydrogenase levels in non-small cell lung cancer tissues.
16820886 2006 Deficient expression of the DPD gene is caused by epigenetic modification in biliary tract cancer cells, and induces high sensitivity to 5-FU treatment.
16806531 2006 The role of Sp1 and Sp3 in the constitutive DPYD gene expression.
16786143 2006 The relationship between survival and the expression of dihydropyrimidine dehydrogenase in patients with colorectal cancer.
16771603 2006 Pharmacogenetic screening for polymorphisms in drug-metabolizing enzymes and drug transporters in a Dutch population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16361556 2005 Methylation of the DPYD promoter: an alternative mechanism for dihydropyrimidine dehydrogenase deficiency in cancer patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16328315 2005 TYMS and DPYD polymorphisms in a Turkish population.
16132996 2006 Thymidine phosphorylase, dihydropyrimidine dehydrogenase and thymidylate synthase mRNA expression in primary colorectal tumors-correlation to tumor histopathology and clinical follow-up.
16021908 2005 Sequence analysis of the 5'-flanking regions of human dihydropyrimidine dehydrogenase gene: identification of a new polymorphism related with effects of 5-fluorouracil.
15999119 2005 Expression of thymidylate synthase, dihydropyrimidine dehydrogenase, thymidine phosphorylase, and orotate phosphoribosyl transferase in prostate cancer.
15993511 2005 The role of thymidylate synthase and dihydropyrimidine dehydrogenase in resistance to 5-fluorouracil in human lung cancer cells.
15939134 2005 [Dihydropyrimidine deshydrogenase (DPD): rhythm and consequences].
15709212 2005 Cancer pharmacogenomics: powerful tools in cancer chemotherapy and drug development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15316940 2004 Thymidylate synthase and dihydropyrimidine dehydrogenase gene expression in relation to differentiation of gastric cancer.
15254700 2004 Thymidine phosphorylase and dihydropyrimidine dehydrogenase expression in hepatocellular carcinoma and metastatic liver cancer.
15132136 2004 Dihydropyrimidine dehydrogenase pharmacogenetics in the Taiwanese population.
15102667 2004 Rapid identification of dihydropyrimidine dehydrogenase deficiency by using a novel 2-13C-uracil breath test.
15069545 2004 Comparative analysis of thymidine phosphorylase and dihydropyrimidine dehydrogenase expression in gastric and colorectal cancers.
15025795 2004 Dihydropyrimidine dehydrogenase and thymidylate synthase polymorphisms and their association with 5-fluorouracil/leucovorin chemotherapy in colorectal cancer.
15017333 Mutations in exon 14 of dihydropyrimidine dehydrogenase and 5-Fluorouracil toxicity in Portuguese colorectal cancer patients.
14702180 2004 The prognostic significance of thymidine phosphorylase, thymidylate synthase and dihydropyrimidine dehydrogenase mRNA expressions in breast carcinomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654904 2004 DPD activity and immunohistochemical DPD expression in human breast cancer.
14562021 2003 Both gene expression for orotate phosphoribosyltransferase and its ratio to dihydropyrimidine dehydrogenase influence outcome following fluoropyrimidine-based chemotherapy for metastatic colorectal cancer.
14519634 2003 Thymidylate synthase and dihydropyrimidine dehydrogenase mRNA expression levels: predictors for survival in colorectal cancer patients receiving adjuvant 5-fluorouracil.
12851836 2003 Clinical implications of dihydropyrimidine dehydrogenase (DPD) activity in 5-FU-based chemotherapy: mutations in the DPD gene, and DPD inhibitory fluoropyrimidines.
12844478 2003 Impact of dihydropyrimidine dehydrogenase on 5-fluorouracil treatment in cancer patients.
12822071 2002 [Mutations in the dihydropyrimidine dehydrogenase gene and their role in 5-fluororuracil intolerance].
12576451 2003 Combination of dihydropyrimidine dehydrogenase and thymidylate synthase gene expressions in primary tumors as predictive parameters for the efficacy of fluoropyrimidine-based chemotherapy for metastatic colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12360106 2002 High prevalence of the IVS14 + 1G>A mutation in the dihydropyrimidine dehydrogenase gene of patients with severe 5-fluorouracil-associated toxicity.
12209976 2002 Increased risk of grade IV neutropenia after administration of 5-fluorouracil due to a dihydropyrimidine dehydrogenase deficiency: high prevalence of the IVS14+1g>a mutation.
12047484 2002 Allele and genotype frequencies of polymorphic cytochromes P450 (CYP2C9, CYP2C19, CYP2E1) and dihydropyrimidine dehydrogenase (DPYD) in the Egyptian population.
12025228 2002 Dihydropyrimidine dehydrogenase enzyme deficiency: clinical and genetic assessment of prevalence in Turkish cancer patients.
11992400 2002 Thymidine kinase in epithelial ovarian cancer: relationship with the other pyrimidine pathway enzymes.
11988088 2002 Novel disease-causing mutations in the dihydropyrimidine dehydrogenase gene interpreted by analysis of the three-dimensional protein structure.
11555601 2001 Prevalence of a common point mutation in the dihydropyrimidine dehydrogenase (DPD) gene within the 5'-splice donor site of intron 14 in patients with severe 5-fluorouracil (5-FU)- related toxicity compared with controls.
11267945 2001 Germline mutation of dihydropyrimidine dehydrogenese gene among a Japanese population in relation to toxicity to 5-Fluorouracil.
11072080 2000 Molecular cloning and characterization of the human dihydropyrimidine dehydrogenase promoter.
10923099 2000 Dihydropyrimidine dehydrogenase activity in human pancreatic tumor tissues.
10606257 1999 Oral fluoropoyrimidines.
10410956 1999 Radiochemical assay for determination of dihydropyrimidinase activity using reversed-phase high-performance liquid chromatography.
9723824 1998 Dihydropyrimidine dehydrogenase pharmacogenetics in Caucasian subjects.
9472650 1998 Dihydropyrimidine dehydrogenase pharmacogenetics in patients with colorectal cancer.
9464498 1998 Suicidal inactivation of human dihydropyrimidine dehydrogenase by (E)-5-(2-bromovinyl)uracil derived from the antiviral, sorivudine.
9439663 1997 Dihydropyrimidine dehydrogenase (DPD) deficiency: identification and expression of missense mutations C29R, R886H and R235W.
9348115 1997 Subcellular localization of dihydropyrimidine dehydrogenase.
9266349 1997 Identification of novel point mutations in the dihydropyrimidine dehydrogenase gene.
9170156 1997 Lack of correlation between phenotype and genotype for the polymorphically expressed dihydropyrimidine dehydrogenase in a family of Pakistani origin.
9135003 1997 Structural organization of the human dihydropyrimidine dehydrogenase gene.
8892022 1996 A point mutation in an invariant splice donor site leads to exon skipping in two unrelated Dutch patients with dihydropyrimidine dehydrogenase deficiency.
8221682 1993 Dihydropyrimidine dehydrogenase activity in human peripheral blood mononuclear cells and liver: population characteristics, newly identified deficient patients, and clinical implication in 5-fluorouracil chemotherapy.
8083224 1994 cDNA cloning and chromosome mapping of human dihydropyrimidine dehydrogenase, an enzyme associated with 5-fluorouracil toxicity and congenital thymine uraciluria.
7713523 1994 Assignment of the human dihydropyrimidine dehydrogenase gene (DPYD) to chromosome region 1p22 by fluorescence in situ hybridization.
3335642 1988 Familial deficiency of dihydropyrimidine dehydrogenase. Biochemical basis for familial pyrimidinemia and severe 5-fluorouracil-induced toxicity.
2528450 1989 Dihydropyrimidine dehydrogenase activity in human blood mononuclear cells.
2319593 1990 Rubredoxin reductase of Pseudomonas oleovorans. Structural relationship to other flavoprotein oxidoreductases based on one NAD and two FAD fingerprints.
1901022 1991 A homologue of a nuclear-coded iron-sulfur protein subunit of bovine mitochondrial complex I is encoded in chloroplast genomes.
1544906 1992 Mechanism-based inactivation of dihydropyrimidine dehydrogenase by 5-ethynyluracil.
1512248 1992 Purification and characterization of dihydropyrimidine dehydrogenase from human liver.