Property Summary

NCBI Gene PubMed Count 15
PubMed Score 29.14
PubTator Score 14.99

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQF      1 - 70
TAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQE     71 - 140
TRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVS    141 - 210
VEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCP    211 - 280
DCAKRNKKMMKRLMTVEK                                                        281 - 298
//

Text Mined References (15)

PMID Year Title