Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.31
PubTator Score 44.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 7.0e-03
non primary Sjogren syndrome sicca 1.100 1.5e-02
Polycystic Ovary Syndrome -1.072 2.0e-03

 GWAS Trait (1)

Gene RIF (22)

PMID Text
25486458 There was a concomitant decrease in the phosphorylation of focal adhesion kinase and paxillin, indicating that DPP9 knockdown or enzyme inhibition suppressed the associated adhesion signaling pathway, causing impaired cell movement.
25464020 The DPP9 expressing cell model system is a very useful and promising system for investigating the selectivity and associated toxicity of DPP4 inhibitors on DPP9.
24562348 Whereas DPP9-short is present in the cytosol, DPP9-long localizes preferentially to the nucleus.
24072711 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23704821 Suggest roles for DPP8 and DPP9 in lymphocyte activation and apoptosis and in hepatocytes during liver disease pathogenesis.
23608773 DPP9 was found in macrophages of carotid atherosclerotic plaque and may play a role in disease progression.
23519473 analysis of dipeptidyl peptidases 8 and 9 reveals that they may have compensatory roles
23152501 DPP9 binds to SUMO1 through a novel SUMO1 interacting motif.
22736146 this study demonstrates for the first time that DP8 and DP9 are expressed in breast and ovarian carcinoma cell lines
22001206 residues important for dimer formation and enzymatic activity
21711053 Data identify modification points in the topology of a representative DPP8/9-inhibitor, capable of rendering selectivity for DPP8 over DPP9.
21622624 These findings suggest an important signaling role of DPP9 in the regulation of survival and proliferation pathways.
20534982 This is the first study to demonstrate the presence of DP9 in chronic lymphocytic leukemia.
20043068 DPP8 and DPP9 prevail over canonical DPP-IV/CD26 and FAPalpha in all examined meningioma patients
19667070 DPP9, a poorly characterized cytoplasmic prolyl-peptidase, is rate-limiting for destruction of proline-containing substrates both in cell extracts and in intact cells
19581630 DP8 and DP9 tissue and cellular expression
19268648 results indicate that the biochemical property of DPP9 is very similar to that of DPP8, its homologous protease. DPP9 and DPP8 are likely redundant proteins carrying out overlapping functions in vivo
18940951 The DPP9 gene is not associated with the occurrence or curve severity of AIS. It is neither a disease-predisposition nor a disease-modifying gene of AIS.
18940951 Observational study of gene-disease association. (HuGE Navigator)
16704418 Dipeptidyl peptidase 8 and dipeptidyl peptidase 9 influence cell-extracellular matrix interactions, and thus may regulate tissue remodeling.
16700509 cells overexpressing DP9 exhibit behavioral changesin the presence of ECM components; these effects were independent of enzyme activity
15245913 identification of two forms, their tissue distribution, cytoplasmic localization

AA Sequence

MATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSH      1 - 70
RLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGIT     71 - 140
SYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLW    141 - 210
VANIETGEERRLTFCHQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEV    211 - 280
DESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVE    281 - 350
YIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVW    351 - 420
INVHDIFYPFPQSEGEDELCFLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALT    421 - 490
SGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFV    491 - 560
SHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHA    561 - 630
LQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQV    631 - 700
EIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERY    701 - 770
MDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERH    771 - 840
SIRCPESGEHYEVTLLHFLQEYL                                                   841 - 863
//

Text Mined References (37)

PMID Year Title
25486458 2015 Dipeptidyl peptidase 9 subcellular localization and a role in cell adhesion involving focal adhesion kinase and paxillin.
25464020 Establishment of a dipeptidyl peptidases (DPP) 8/9 expressing cell model for evaluating the selectivity of DPP4 inhibitors.
24562348 2014 The amino terminus extension in the long dipeptidyl peptidase 9 isoform contains a nuclear localization signal targeting the active peptidase to the nucleus.
24072711 2013 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23704821 2013 Regulation of dipeptidyl peptidase 8 and 9 expression in activated lymphocytes and injured liver.
23608773 2013 Dipeptidyl peptidases in atherosclerosis: expression and role in macrophage differentiation, activation and apoptosis.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23519473 2013 Identifying natural substrates for dipeptidyl peptidases 8 and 9 using terminal amine isotopic labeling of substrates (TAILS) reveals in vivo roles in cellular homeostasis and energy metabolism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152501 2012 A novel SUMO1-specific interacting motif in dipeptidyl peptidase 9 (DPP9) that is important for enzymatic regulation.
22736146 2012 Expression profiling of dipeptidyl peptidase 8 and 9 in breast and ovarian carcinoma cell lines.
22001206 2011 Role of a propeller loop in the quaternary structure and enzymatic activity of prolyl dipeptidases DPP-IV and DPP9.
21711053 2011 Structure-activity relationship studies on isoindoline inhibitors of dipeptidyl peptidases 8 and 9 (DPP8, DPP9): is DPP8-selectivity an attainable goal?
21622624 2011 A novel role of dipeptidyl peptidase 9 in epidermal growth factor signaling.
21269460 2011 Initial characterization of the human central proteome.
20534982 2010 Expression and prognostic assessment of dipeptidyl peptidase IV and related enzymes in B-cell chronic lymphocytic leukemia.
20043068 2010 Expression of dipeptidyl peptidase-IV activity and/or structure homologs in human meningiomas.
19667070 2009 The cytoplasmic peptidase DPP9 is rate-limiting for degradation of proline-containing peptides.
19581630 2009 The in vivo expression of dipeptidyl peptidases 8 and 9.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19268648 2009 Biochemical properties and expression profile of human prolyl dipeptidase DPP9.
18940951 2008 Association study between adolescent idiopathic scoliosis and the DPP9 gene which is located in the candidate region identified by linkage analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16704418 2006 Extraenzymatic functions of the dipeptidyl peptidase IV-related proteins DP8 and DP9 in cell adhesion, migration and apoptosis.
16700509 2006 DP8 and DP9 have extra-enzymatic roles in cell adhesion, migration and apoptosis.
16475979 2006 Dipeptidyl peptidases 8 and 9: specificity and molecular characterization compared with dipeptidyl peptidase IV.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15866709 2005 Isoforms of dipeptidyl aminopeptidase IV from Pseudomonas sp. WO24: role of the signal sequence and overexpression in Escherichia coli.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15245913 2004 Dipeptidyl peptidase 9 has two forms, a broad tissue distribution, cytoplasmic localization and DPIV-like peptidase activity.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12662155 2003 Cloning and characterization of dipeptidyl peptidase 10, a new member of an emerging subgroup of serine proteases.
12534281 2003 Structural requirements for catalysis, expression, and dimerization in the CD26/DPIV gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459266 2002 Identification and characterization of human DPP9, a novel homologue of dipeptidyl peptidase IV.