Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.49
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 1.2e-06
Disease Target Count Z-score Confidence
Diphtheria 40 3.847 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
Pick disease -1.200 1.2e-06

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MMGCFALQTVDTELTADSVEWCPLQGCRHLLACGTYQLRRPEDRPAGPQNKGGMEVKEPQVRLGRLFLYS      1 - 70
FNDNNSIHPLVEVQRKDTSAILDMKWCHIPVAGHALLGLADASGSIQLLRLVESEKSHVLEPLSSLALEE     71 - 140
QCLALSLDWSTGKTGRAGDQPLKIISSDSTGQLHLLMVNETRPRLQKVASWQAHQFEAWIAAFNYWHPEI    141 - 210
VYSGGDDGLLRGWDTRVPGKFLFTSKRHTMGVCSIQSSPHREHILATGSYDEHILLWDTRNMKQPLADTP    211 - 280
VQGGVWRIKWHPFHHHLLLAACMHSGFKILNCQKAMEERQEATVLTSHTLPDSLVYGADWSWLLFRSLQR    281 - 350
APSWSFPSNLGTKTADLKGASELPTPCHECREDNDGEGHARPQSGMKPLTEGMRKNGTWLQATAATTRDC    351 - 420
GVNPEEADSAFSLLATCSFYDHALHLWEWEGN                                          421 - 452
//

Text Mined References (9)

PMID Year Title