Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.98
PubTator Score 1.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.200 1.4e-02
acute quadriplegic myopathy 1.134 3.4e-06
atypical teratoid / rhabdoid tumor 1.100 2.3e-03
ependymoma 1.100 1.2e-08
glioblastoma 1.100 7.6e-07
group 3 medulloblastoma 1.200 3.5e-05
intraductal papillary-mucinous neoplasm ... -1.100 1.4e-03
medulloblastoma, large-cell 1.200 2.1e-04
osteosarcoma -1.009 1.1e-02
ovarian cancer -1.300 7.0e-06
pancreatic cancer -1.300 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.282 1.9e-02
pediatric high grade glioma 1.100 2.8e-05
primitive neuroectodermal tumor 1.200 1.4e-03

Synonym

Accession Q9H2P9 A8JZY6 D3DT62 Q9P017 Q9P0I4 Q9Y319
Symbols AD-018
CGI-30
NPD015
HSPC143

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREEVEQEADNILK      1 - 70
DADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTW     71 - 140
RPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEE    141 - 210
PAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQ    211 - 280
SINGL                                                                     281 - 285
//

Text Mined References (17)

PMID Year Title