Property Summary

NCBI Gene PubMed Count 15
PubMed Score 17.49
PubTator Score 12.03

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGPRAAAPPDAPARPAVAGAGRR      1 - 70
SPSDGAREDDEDVDQLFGAYGSSPGPSPGPSPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQEN     71 - 140
NALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRK    141 - 210
TLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFNICLEKQLPVDKTEDKSLEERGRILISLKYSSQK    211 - 280
QGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKS    281 - 350
LEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHTLTSELPGAVLSD            351 - 412
//

Text Mined References (17)

PMID Year Title