Property Summary

NCBI Gene PubMed Count 272
PubMed Score 437.71
PubTator Score 460.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (1)

Gene RIF (267)

PMID Text
27062459 Increasing DNA methylation in the gene-coding area of DNMT3B was associated with higher risk of colorectal adenomas (OR = 1.34; 95% CI: 1.01-1.79 per SD).
26892683 Data indicate an epigenetic prognostic signature in glioblastomas based on expression of polycomb repressive complex 2 (EZH2), DNA-methyltransferases DNMT1 and 3B which can be used easily in routine neuropathology practice.
26729896 Deregulated Dnmt3b targets have prognostic impact in acute myeloid leukemia patients.
26667181 Downregulation of DNMT3B, one of the targets identified using this method, radiosensitizes cancer cells by disturbing multiple DNA damage responses.
26629529 Our results demonstrate DNMT3B4-del as a critical factor in developing aberrant DNA methylation patterns during lung tumorigenesis and suggest that DNMT3B4-del may be a target for lung cancer prevention.
26573490 The HBVX gene upregulated the mRNA and protein expression levels of DNMT3A/3B, downregulated the expression of SOCS1 and increased SOCS1 gene promoter CpG island methylation.
26556862 Data show that microRNA miR-221 contributes to breast cancer tumorigenicity by regulating stemness, at least in part through the control of DNA methyltransferase 3B (DNMT3b) expression.
26505438 Results suggested that the DNMT3B -149C/T polymorphism is associated with a genetic susceptibility for developing LSCC in a Chinese population.
26497367 miR-124 and miR-506 inhibit progression and increase sensitivity to chemotherapy by targeting DNMT3B and DNMT1 in colorectal carcinoma.
26485042 For DNMT3B, increasing DNA methylation of CpG sites in the gene-coding area was associated with a higher risk of colorectal adenomas.
26416384 To correlate DNMTs expression with DNA methylation, DNMT1, DNMT3A and DNMT3B mRNA levels in 5 colorectal cancer cell lines; results suggest that cellular DNMT expression is positively correlated with global DNA methylation level but not with regional DNA hypermethylation at each locus.
26406961 DNMT3B-579G>T polymorphism might contribute to the susceptibility of cancers especially in the Asian population and for colorectal cancer
26305882 DNMT1, DNMT3B, and EZH2 were expressed at significantly higher levels in tumor vs. normal tissues.
26262893 DNMT3b polymorphisms may predict long-term survival of gastric cancer. However, further studies are needed to reveal the underlying biological roles of DNMT3b polymorphism.
26239024 The inability to downregulate DNMT3B expression in Endometriosis may contribute to an aberrant epigenetic fingerprint that misdirects gene expression in endometriosis and contributes to its altered response to steroid hormones.
26098813 Here, we summarize the evidence on the DNA dehydroxymethylase and demethylase activity of DNMT-3A and -3B.
25899090 There were no significant differences in DNMT3b mRNA expression between patients with SLE and healthy controls.
25822089 Disruption of DNMT3A or DNMT3B individually as well as of both enzymes in tandem results in viable, pluripotent cell lines with distinct effects on the DNA methylation landscape.
25815896 low levels of miR-29c in the CSF were positively correlated with the protein expression of BDNF and negatively correlated with the protein expression of DNMT3 in patients with AD.
25769449 Our results suggest that DNA (cytosine-5-)-methyltransferase 3 beta polymorphism is involved in the development of colon cancer and non-random genes promoter methylation among Iranian population.
25749421 Overexpression of DNMT3b is associated with radioresistance in prostate cancer.
25746661 The data suggest that deregulation of DNMT1, DNMT3B and miR29 may be involved in Burkitt lymphoma pathogenesis.
25705251 HIV-1 Tat upregulates DNMT1, DNMT3A, and DNMT3B both at the mRNA and protein levels in primary tumors
25656965 DNMT3B might be a maternal risk factor for Down syndrome in our Indian cohort.
25607950 Results show that DNMT3B7 expression, resulting from alternate splice site, is increased in breast cancer patient tissues and in vitro studies suggest a role for DNMT3B7 in the progression of breast cancer to a more aggressive state.
25550796 expression of DNMT3A or DNMT3B was an independent prognostic factor for disease-free survival in renal cell carcinoma.
25530201 Results suggest that DNMT3B polymorphisms may explain variability in the IQ response to either enriched or impoverished environmental conditions.
25515408 DNMT3B polymorphisms might be associated with decreased cancer risk especially in the Asian population and for colorectal cancer.
25452147 DNA hypermethylation in late onset Alzheimer's disease was paralleled by higher DNMT3b gene expression, but not protein level.
25433949 Our meta-analysis suggested that DNMT3B -149C/T polymorphism was associated with the risk of head and neck cancer under heterozygote comparison and dominant model, although no evidence of association was observed as we compared in the pooled analyses
25420499 Analysis of DNA methylation in CpG islands of target genes revealed high co-localization of DNMT1 and DNMT3B on the promoters of TSGs associated with enhanced CpG hypermethylation
25392095 The osteogenesis differentiation of hUMSCs is impaired in the absence of DNMT3B.
25204569 High DNMT3B expression independently associates with adverse outcome in older cytogenetically normal primary acute myeloid leukemia patients.
25126948 These results suggest that environmental factors played a more crucial role in UC carcinogenesis than did the DNMT3A -448A>G and DNMT3B -579G>T gene polymorphisms.
25122426 We reveal a new mechanism that FOXO3a transcriptionally represses DNMT3B expression and this regulation can be attenuated by MDM2 overexpression in human lung cancer model.
25083817 High DNA-methyltransferase 3B expression predicts poor outcome in acute myeloid leukemia, especially among patients with co-occurring NPM1 and FLT3 mutations.
25038421 study found carriers of the DNMT3B TGG haplotype were associated with Alzheimer's disease
25027325 DNMT3B-deficient induced pluripotent stem cells exhibit global loss of non-CG methylation and select CG hypomethylation at gene promoters and enhancers are associated with the ICF syndrome.
24952347 DNMT3L can address DNMT3A/B to specific sites by directly interacting with TFs that do not directly interact with DNMT3A/B
24859147 DNMT3B rs2424932 genotype (P = 0.023) and allele (P = 0.0063) increased the risk of developing schizophrenia in males but not in females.
24625449 Activated IL-6 signaling might be responsible to the induction of DNMT3b overexpression on oral cancer
24603304 Our finding suggests that DNMT3B acts as an antiapoptotic gene in teratocarcinoma stem cells, and mediates apoptosis and differentiation of human pluripotent stem cells induced by Aza-dC
24577265 DNMT3B may be regulating enteric nervous system development through DNA methylation in the neural crest cells, suggesting that aberrant methylation patterns could have a relevant role in Hirschsprung disease.
24469050 Our results identify a key role for DNMT3b in the earliest stages of initiation and provide a comprehensive catalog of genes targeted for silencing by this methyltransferase in non-small-cell lung cancer.
24459426 Association of self-DNA mediated TLR9-related gene, DNA methyltransferase, and cytokeratin protein expression alterations in HT29-cells to DNA fragment length and methylation status.
24457336 Expression of myeloperoxidase in acute myeloid leukemia blasts mirrors the distinct DNA methylation pattern involving the downregulation of DNA methyltransferase DNMT3B.
24362509 SHMT1 C1420T and DNMT3B C46359T polymorphisms are not associated with HNC development in Brazilian population, however, SHMT1 C1420T polymorphism is less frequent in patients with primary site of tumor in larynx
24343426 High DNMT3B expression was associated with tongue squamous cell carcinoma.
24333507 A role of DNMT3B in controlling the differentiation of human embryonic stem cells and in the generation of induced pluripotent stem cells.
24316981 Fusion of TTYH1 with the C19MC microRNA cluster drives expression of a brain-specific DNMT3B isoform in the embryonal brain tumor.
24260492 the DNMT3B-579T allele might contribute to the risk of developing thymoma in MG patients, particularly in homozygous TT subjects.
24201117 Foxp3 downregulation in HIV-infected Treg was related to an increase in the expression of DNA methyltransferase3b (DNMT3b) associated with higher methylation of CpG sites in the FOXP3 locus.
24178910 In conclusion, no significant association was found between the -149C>T polymorphisms in DNMT3B and colorectal cancer susceptibility.
24127215 Nonrandom template segregation in differentiating embryonic stem cells is dependent on DNA methylation and on Dnmt3A/B.
24098518 common variants in the DNMT1 and DNMT3B genes influence inter-individual variation in global DNA methylation and the three loci investigated here.
24094886 DNMT3B7 overexpression might interfere with the normal DNA methylation mechanism required for silencing the MENT proto-oncogene, and may accelerate human lymphomagenesis.
24069326 DNMT3B polymorphisms may contribute to the genetic susceptibility to AML; in particular, the G allele of rs1569686 serves as a risk factor for AML, whereas the C allele of rs2424908 represents a potential protective factor.
24028770 PU.1- targeted genes undergo Tet2-coupled demethylation and DNMT3b-mediated methylation in monocyte-to-osteoclast differentiation.
24001151 Mahanine treatment induces the proteasomal degradation of DNMT1 and DNMT3B via the inactivation of Akt, which facilitates the demethylation of the RASSF1A promoter and restores its expression in prostate cancer cells.
23894490 our work contributes new insights into the regulation of de novo DNA methylation by inactive DNMT3B isoforms in human cells.
23820632 The decreased expression of DNMT1 and DNMT3B mRNA may play an important role in the pathogenesis of TOF.
23677709 The 46359CT polymorphism of DNMT3B is associated with the risk of cervical cancer.
23636939 Inactivation of DNMT3B splice variants might play an important role in cell proliferation correlating with the change of p21.
23545144 These results demonstrated that down-regulation of DNMT1 or DNMT3B expression in Huh7.5.1 cells severely impaired cell culture-produced hepatitis C virus infection.
23486536 Clinical and genetic data of mutations in DNMT3B and ZBTB24 in patients with ICF syndrome, were compared.
23393137 mammalian DNMT1, DNMT3B, and, to a much less extent, DNMT3A, can also act in vitro as DNA demethylases in a Ca2+ ion- and redox state-dependent manner
23251566 This study represents the first report showing that the overexpression of DNMT3B/3B(NC) is an independent predictor of poor survival in acute myeloid leukemia.
23100393 High DNMT3B expression is associated with multiple myeloma.
23081874 Combinations of functional DNMT3B promoter polymorphisms are associated with maternal risk of birth of a child with Down syndrome.
23079992 Two SNPs, rs16999593 in DNMT1 and rs2424908 in DNMT3B, are significantly associated with breast cancer risk.
23049596 No significant differences were found in the genotype distribution of DNMT3B polymorphism between the children with ITP and the control group.
23039890 DNMT3B-579G/T, MTHFR+677C/T and +1298A/C polymorphisms were not correlated with the development or prognosis of AITD.
23025623 Allelic variability in DNMT3B may be relevant to the underlying diathesis for suicidal acts.
23000068 DNMT3B -579 TT homotype was significantly higher in immune thrombocytopenic purpura (ITP) patients and conferred almost three fold increased risk of ITP (OR=3.16, 95%CI=1.73-5.79).
22898819 mammalian de novo DNA methyltransferases DNMT3A and DNMT3B are also DNA 5-hydroxymethylcytosine dehydroxymethylases
22885766 Association between a single nucleotide polymorphism (SNP) in the promoter of DNMT3B gene and the risk for ITP was investigated.
22815530 Our results indicate that DNMT3B7 modifies the epigenome in neuroblastoma cells to induce changes in gene expression and inhibit tumor growth
22810147 Findings provide clues on the role of a DNMT3b SNP in prostate cancer progression.
22768205 The data from this study provided the first evidence for differential expression of DNMTs proteins in ovarian cancer tissues and their associations with clinicopathological and survival data in sporadic ovarian cancer patients.
22664488 DNMT3b-mediated hypermethylation defect in breast cancer cell lines involves the loss of post-transcriptional regulation of DNMT3b by regulatory miRs.
22572543 finding that DNA (cytosine-5-)-methyltransferase 3 beta (DNMT3B) correlates with the severity of dysmenorrhea suggests that DNA (cytosine-5-)-methyltransferases may be involved in adenomyosis-caused dysmenorrhea and its severity
22563479 Results show that DNMT3B is dispensable for the maintenance of aberrant DNA methylation patterns in colon cancer cells.
22547080 Pregnancy and the DNMT3b genotype independently influence the arsenic methylation phenotype
22520950 data suggest that overexpression of DNMT1, DNMT3a, and DNMT3b might represent a critical event responsible for the epigenetic inactivation of multiple tumor suppressor genes, leading to the development of aggressive forms of sporadic breast cancer
22490141 The -579 G allele is a potential protective factor for the occurrence of colorectal cancer; the polymorphism of DNMT3B-149 gene shows no close correlation with the occurrence and development of CRC among Chinese population.
22394436 Patients with seminomas showing focal DNMT3B expression are at increased risk of relapse, and should be followed up carefully.
22378288 ICF related mutations in DNMT3B (K770E,D817G)alter DNA replication in ICF cell lines.
22349384 Decreased expression levels of DNMT1, DNMT3a, and DNMT3b in the ectopic endometrium and eutopic endometrium may play a role in patients with abnormal epigenetics which may lead to endometriosis.
22301400 Increased DNMT3B gene expression is associated with carcinogenesis in pancreatic ductal adenocarcinoma.
22272627 Analysis of Italian late-onset Alzheimer's disease (LOAD) patients and matched controls revealed no difference in allele frequencies. No significant effect on disease age at onset was observed.
22244828 Report aberrant DNMT3B regulation in colon cancer and suggest that its expression is associated with the methylation of constitutively hypermethylated promoters in the healthy colon.
22236544 The data shows that the DNMT3B (C46359T) polymorphism is associated with oral lichen planus development. Furthermore, increased expression of the enzyme DNMT3B, an epigenetic-associated protein, is present in oral lichen planus.
22207353 Results indicate that DNMT3B mediates large-scale methylation patterns in human embryonic stem cells and that DNMT3B deficiency in the cells alters the timing of their neuronal differentiation and maturation.
22072770 Elevated expression of DNMT1 or DNMT3B alone is not required to maintain restricted latency.
22056872 Estrogen receptor alpha is downregulated by TWIST1 (Twist) recruitment of DNMT3B.
22048249 The analysis of DNMT3B expression showed peaks of mRNA transcripts in primary spermatocytes and in mature ejaculated spermatozoa
22009713 A functional sequence variant in DNMT3B is associated with the development of Secondary primary cancers in head and neck cancers early stage patients treated with radiation.
21938431 -579G > C polymorphism in DNMT3B is associated with risk of cancer in Asians [0.68 (0.53-0.87) for GT vs. TT] but not in Europeans [0.82 (0.63-1.07) for GT vs. TT].
21909138 MTSS1, a novel target of DNMT3B, is repressed by DNMT3B via a DNA methylation-independent mechanism in hepatocellular carcinoma cells
21887463 Significantly higher levels of CXCR4, DNMT3A, DNMT3B and DNMT1 transcript (p=0.0058, 0.0163, 0.0003 and <0.0001, respectively) levels in cancer tissue as compared to normal samples.
21854760 These preliminary findings suggest that genetic variance may influence DNMT3B expression in pancreatic cancer.
21757290 Data show that Core inhibited p16 expression by inducing promoter hypermethylation via up-regulation of DNMT1 and DNMT3b.
21712824 It was found that the methylator phenotype of Yolk Sac Tumors (YSTs) was coincident with higher levels of expression of the DNA methyltransferase, DNA (cytosine-5)-methyltransferase 3B, suggesting a mechanism underlying the phenotype.
21698279 tightly controlled down regulation of DNMT3B exon 10 containing transcripts (and exon 10 encoded peptide) upon spontaneous differentiation of PSCs suggests that this DNMT3B splice isoform is characteristic of the pluripotent state
21592522 Data show that the levels of DNMT3B mRNA in MDD were significantly increased in a depressive but not in a remissive state.
21559330 in ICF lymphoblasts and peripheral blood, juxtacentromeric heterochromatic genes undergo dramatic changes in DNA methylation, indicating that they are bona fide targets of the DNMT3B protein
21549127 study reveals a novel level of coupling between substrate binding, oligomerization, and catalysis that is likely conserved within the DNMT3 family of enzymes
21521786 DNMT3B1 and DNMT3B2 overexpression resulted in increased methylation of a substantial subset of CpG sites that showed tumor-specific increased methylation in prostate cancer.
21519807 The results showed that the -579G allele of DNMT3B was associated with a significantly decreased risk of colorectal cancer.
21490393 DNA methyltransferase 3b methylates genes in a similar way in mouse intestine and human colon cancer
21482616 Data suggest that the global methylation status of germ cells is not affected by spermatogenic defects in spite of aberrant DNMT3B expression indicating the necessity of proper methylation for full spermatogenesis.
21304883 these data suggest an inheritance model where DNMT3A/3B remain localized to silent methylated domains by binding to nucleosomes containing methylated DNA, enabling faithful maintenance of methylated states in cooperation with DNMT1.
21229291 we report significant overexpression of DNMT1 and DNMT3B in glioma
21211326 A gene-gene interaction between DNMT3B and DRD1 was observed in schizophrenia.
21154337 DNMT3B gene is associated with early-onset schizophrenia and rs6119954 may plays an important role in age of onset of schizophrenia.
21106767 Results suggest that multidrug resistance is related to overexpression of BCRP/ABCG2 and the decrease of DNA methyltransferases, especially DNMT3b
21081840 DNMT3B has a significant roles in melanoma progression, and may be useful epigenetic biomarkers for disease outcome.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20980350 Depletion of DNMT3b also reduced DNMT3a mRNA and protein
20970125 DNMT3B (DNA-methyltransferase 3 beta) mRNA is expressed temporally in the endometrium across the menstrual cycle.
20960050 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20952535 Results reveal a compelling new mechanism of RNA-dependent DNA methylation, suggesting that recruitment of DNMT3b by DNA:RNA triplexes may be a common and generally used pathway in epigenetic regulation.
20838592 This study offers insights into the manner by which DNA methylation patterns are deposited and reveals a new level of interplay between members of the de novo DNMT family.
20833755 In biochemical assays, nanaomycin A revealed selectivity toward DNMT3B.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20593030 Observational study of gene-disease association. (HuGE Navigator)
20514408 Nucleotide polymorphism of DNMT3B is not associated with methylation of p16CDKN2A gene in head and neck squamous cell carcinoma.
20514408 Observational study of gene-disease association. (HuGE Navigator)
20506537 Data demonstrate that PI3K/Akt pathway regulates the expression of DNMT3B at transcriptional and post-transcriptional levels, which is particularly important to understand the effects of PI3K/Akt and DNMT3B on hepatocarcinogenesis.
20480259 DNMT3B -579 G>T polymorphism may alter susceptibility to carcinoma of gallbladder
20480259 Observational study of gene-disease association. (HuGE Navigator)
20454457 identifies several important tumor suppressors and transcription factors as direct DNMT3B targets in colon cancer and as potential biomarkers for this cancer. Further, methylation at an upstream CGI of HOXB13 is unique to colon cancer
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448464 Epigenetic alteration of microRNAs in DNMT3B-mutated patients of ICF syndrome
20428781 thymine DNA glycosylase was not up-regulated in DNMT1 nor 3B knockdown cancer cells
20426865 benzo [a]pyrene diol epoxide recruited DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), but not beta to methylate the RAR-beta2 gene promoter in esophageal cancer cells
20398055 DNMT1 and DNMT3b silencing sensitizes human hepatoma cells to TRAIL-mediated apoptosis via up-regulation of TRAIL-R2/DR5 and caspase-8.
20398054 DNMT3b overexpression is an independent prognostic factor for predicting shortened survival of patients with diffuse large B-cell lymphomas.
20381446 associated with a decreased risk for CIMP+ colorectal cancer
20381114 expression of DNA methyltransferase 1, 3a, and 3b showed significantly higher levels in stage IV tumors than in stage I or II tumors
20375073 increased binding of DNMT3b to E-cadherin promoter region by K-Ras cause promoter hypermethylation for reduced expression of E-cadherin, leading to the decreased cell aggregation and increased metastasis of human prostate cancer cells.
20127025 Elevated DNMT3B variants may influence the progression of gastric cancer and may possibly be a powerful indicator for the disease.
19932585 Our results indicate that DNMT1 plays the main role in maintenance of methylation of CXCR4 promoter, while DNMT3B may function as an accessory DNA methyltransferase to modulate CXCR4 expression in AsPC1 cells.
19896490 Observational study of gene-disease association. (HuGE Navigator)
19854132 RASSF1A silencing strongly correlates with overexpression of HOXB3 and DNMT3B.
19843671 DNMT3B polymorphisms are associated with colorectal cancer.
19843671 Observational study of gene-disease association. (HuGE Navigator)
19825994 DNMT3B3Delta5 may play an important role in stem cell maintenance or differentiation and suggest that sequences encoded by exon 5 influence the functional properties of DNMT3B.
19798569 Our data suggest there is no apparent association of common DNMT-1 and DNMT-3B polymorphisms with the risk of breast cancer in Chinese women.
19798101 Np95, Dnmt3a and Dnmt3b in mediating epigenetic silencing through histone modification followed by DNA methylation
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786833 description of direct interaction between Dnmt3a and/or Dnmt3b and transcription factors provides rational molecular explanation to the mechanisms of targeted DNA (hyper)methylation.
19777235 The -283C/T polymorphism of the DNMT3B gene influences the progression of joint destruction in rheumatoid arthritis.(
19777235 Observational study of gene-disease association. (HuGE Navigator)
19763880 The expression of DNMT1, DNMT2, DNMT3A and DNMT3B in pediatric acute lymphoblastic leukemia patients, was investigated.
19696477 It is shown that the SNP of DNMT3B 579G>T may not be used on its own as a marker to predict the susceptibility to ITP in a Chinese population and that DNMT3B 579G>T promoter SNP varies from one ethnic population to another.
19696477 Observational study of gene-disease association. (HuGE Navigator)
19680556 Observational study of gene-disease association. (HuGE Navigator)
19626461 DNMT3B G39179T single nucleotide polymorphism may be a potential genetic susceptibility factor for adenocarcinoma of the colon, especially in younger Chinese Han non-drinker men.
19626461 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19620278 nucleosomes containing methylated SINE and LINE elements and CpG islands are the main sites of DNMT3A/3B binding.
19576953 DNMT3B may be a candidate gene for susceptibility to early onset schizophrenia.
19517237 Results showed that individuals with at least one -579G allele were also at significantly decreased risk of gastric cancer [odds ratio (OR), 0.43; 95% confidence interval (CI) 0.26-0.72] compared with those having a -579TT genotype.
19517237 Observational study of gene-disease association. (HuGE Navigator)
19502167 DNMT3b may play an important role in regulation of FHIT expression in hepatoma SMMC-7721 cells, but not through methylation of the FHIT promoter.
19482874 DNMT3B interacts with CENP-C to modulate DNA methylation and the histone code at centromere.
19470733 Data support a possible role of DNMT3B in nonrandom de novo CpG island methylation leading to colorectal cancer.
19465937 the role of promoter region DNA hypermethylation as a mediator of gene silencing in glioblastoma multiforme cell line using RNAi directed against DNMT1 and DNMT3b was investigated.
19465161 Investigated the DNMT3B 149 TT genotype and found it not significantly ass'd w/inc'd risk of hepatocellular carcinoma; but stratification analysis detected a trend towards a risk in female subset of patients and a lesser risk for HCV-infected patients.
19451595 Results show that folate supplementation enhanced the DNA remethylation through the Sp1/Sp3-mediated transcriptional up-regulation of genes coding for Dnmt3a and Dnmt3b proteins.
19399408 Silencing DNMT3b and DNMT1 could inhibit the cell growth and promote apoptosis of bladder carcinoma cells.
19326430 DNMT3B C-149T polymorphism is associated with colorectal cancer.
19326430 Observational study of gene-disease association. (HuGE Navigator)
19246518 Observational study of gene-disease association. (HuGE Navigator)
19211935 Down-regulation of DNMT3B results from direct interaction of miR-29b with its 3' untranslated region.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19107573 Over-expression of DNMT3B treated with 17 beta-estradiol(E(2)) was confirmed by real-time PCR and western blotting analysis. Furthermore, the up-regulation of DNMT3B expression induced by E(2) was suppressed by the addition of ICI182780.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19024105 role of deltaDNMT3B4/2 in regulating RASSF1A promoter-specific DNA methylation in non-small cell lung cancer.
19019622 Down-regulation of CXCR4 expression by tamoxifen is associated with DNA methyltransferase 3B up-regulation in MCF-7 breast cancer cells.
18829110 a negative association of DNMT3a and 3b expression with MDS disease risk
18762900 S270P mutation affects DNMT3B functions via specific, non-covalent interaction with SUMO-1.
18683034 Decreased mRNA expression in peripheral blood mononuclear cells in patients with idiopathic thrombocytopenic purpura
18662374 the DNMT3B -579G>T polymorphism may contribute to the genetic susceptibility to colorectal cancer.
18639864 DNMT gene transcript expression was altered in several brains regions of suicides, including frontopolar cortex, amygdala, and paraventricular nucleus of the hypothalamus. Increased mRNA and protein expression was found in the frontopolar cortex.
18567530 Results show that DNA methyltransferase 3B enhances polycomb protein 2-mediated transcriptional repression of FGFR3, and suggest that DNMT3B is a co-repressor of hPc2 in inducing transcriptional repression independent of DNA methylation.
18563322 DNMT1 and DNMT3b will increase their biological effects and have a synergistic effect on suppressing the growth of cholangiocarcinoma
18544619 DNMT3b as a putative mediator of epigenetic control through histone modifications of gene expression in pituitary cells.
18499700 The association between sequence variants of DNMT1 and 3B and mutagen sensitivity induced by BPDE supports the involvement of these DNMTs in protecting the cell from DNA damage.
18499700 Observational study of gene-disease association. (HuGE Navigator)
18455294 This large study provides reliable risk estimates for associations between DNMT3B variants and SCCHN risk in non-Hispanic whites
18455294 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18437543 It has been demonstrated that it may not be used as a stratification marker to predict the susceptibility to idiopathic thrombocytopenic purpura in Chinese population
18437543 Observational study of gene-disease association. (HuGE Navigator)
18414412 DNMT3b may play an important role in modulating NSCLC patient survival and thus be useful for identifying NSCLC patients who would benefit most from aggressive therapy.
18413740 Chromatin immunoprecipitation analysis of the BAG-1 promoter in DNMT1-overexpressing or DNMT3B-overexpressing colon cells show a permissive chromatin status assoscsiated with DNA binding of BORIS.
18407600 DNMT3B 579 G>T promoter polymorphism does not have a role in susceptibility to esophageal carcinoma in Chinese
18407600 Observational study of gene-disease association. (HuGE Navigator)
18367714 Whereas overexpression of miR-148 results in decreased DNMT3b1 expression, short-hairpin RNA-mediated miR-148 repression leads to an increase in DNMT3b1 expression.
18336997 There is no significant association between the DeltaDNMT3B C>T SNP and early onset CRC in HNPCC patients.
18336997 Observational study of gene-disease association. (HuGE Navigator)
18268116 Polymorphisms in DNMT3B may be associated with colorectal adenoma risk in the context of low folate and methionine intake.
18268116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18253830 DNMT3b was over expressed in gastric neoplasms.
18221536 DNMT3b overexpression is associated with human breast cancer
18097598 DNMT3B might not play a role in hypermethylation of many tumor suppressor genes during carcinogenesis of NPC
18029387 DNMT3B mutations in ICF syndrome lead to altered epigenetic modifications and aberrant expression of genes regulating development, neurogenesis and immune function.
18023104 genotype and allelotype distribution in Chinese Han hepatocellular carcinoma patients was not significantly different from that in controls
18023104 Observational study of gene-disease association. (HuGE Navigator)
18006804 promoter DNA methylation can be differentially regulated and DeltaDNMT3Bs are involved in regulation of such promoter-specific de novo DNA methylation
17998942 the autocrine hGH-stimulated increases in DNMT3A and DNMT3B expression mediate repression of plakoglobin gene transcription by direct hypermethylation of its promoter and consequent phenotypic conversion of mammary carcinoma cells
17991895 reveals novel functions for DNMT1 as a component of the cellular response to DNA damage, which may help optimize patient responses to this agent in the future
17890317 Expression of microRNA is inversely correlated with DNMT3B in non-small cell lung cancer.
17705213 Early prenatal diagnosis of ICF syndrome by mutation detection.
17688412 We found clinically relevant levels of Hcy (0-500 microM) induced elevation of SAH, declination of SAM and SAM/SAH ratio and reduced expression of SAHH and MBD2, but increased activity of DNMT3a and DNMT3b affecting DNA methylation
17538945 Progressive up-regulation of the gene encoding DNMT3B was found in the colorectal adenoma-carcinoma sequence.
17532557 DNMT1 plays a key role in maintenance of methylation, and DNMT3B may act as an accessory DNA methyltransferase to epigenetically silence CXCL12 expression in MCF-7 and AsPC1 cells
17369845 tobacco exposure induces the abnormal expression of SNCG in lung cancer cells through downregulation of DNMT3B
17353906 Results suggest that truncated DNMT3B proteins could play a role in the abnormal distribution of DNA methylation found in cancer cells.
17318376 Observational study of gene-disease association. (HuGE Navigator)
17318376 The DNMT3b 39179GT polymorphism may be a genetic determinant of adenocarcinoma of the colon, especially in younger Korean men.
17303076 results showed for the first the direct linkage between DNMT and zinc-fingers homeoboxes protein, leading to enhanced gene silencing by DNMT3B
17277043 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17149367 The p16 gene promoter was hypermethylated in pterygia, and this hypermethylation was strongly linked to expression of the positive expression of DNMT3b protein and to the suppression of p16 protein.
17081533 The genes DNMT1, DNMT3A, and DNMT3B were over-expressed in the ectopic endometrium as compared with normal control subjects or the eutopic endometrium of women with endometriosis
17067458 Correlation between the expression of DNMT3b and the methylation of tumor suppressor genes, tumor grade and stage was not found.
17017004 Expression of DNMT3B was inversely correlated with that of p14ARF and p16INK4a. Results suggest that DNMT3B over-expression may be involved in the suppression or lower expression of p14ARF and p16INK4a observed in esophageal squamous cell carcinoma.
16951151 RAS oncogene induces RECK gene silencing through DNMT3b-mediated promoter methylation which may be useful in treatment of cancer metastasis
16951144 Expression of DNMT3B variants is common in nsn-small cell lung carcinoma and may play an important role in the development of promoter methylation.
16920385 Observational study of gene-disease association. (HuGE Navigator)
16920385 The relative distribution of three DNMT3B SNPs among a Taiwanese population can not be used as a stratification marker to predict either an individual's susceptibility to HNSCC and/or the likelihood of cervical metastasis of HNSCC.
16773201 DeltaDNMT3B is the predominant form of DNMT3B in non-small cell lung cancer.
16543361 Dnmt3b-Dnmt3L interactions play an important role in the regulation of DNA methylation during mammalian development.
16501248 Observational study of gene-disease association. (HuGE Navigator)
16501171 Dnmt3b plays an essential role at different stages of mouse development, and that Immunodeficiency, Centromeric instability and Facial anomalies missense mutations cause partial loss of function
16481298 Transfection with the antisense DNMT3b gene eukaryotic expression plasmid can significantly reduce the expression level of the DNMT3b gene in the human biliary tract carcinoma cell line QBC-939.
16463117 we observed that the increase (10%) of genomic DNA methylation in patients with alcoholism was significantly associated with their lowered DNMT-3b mRNA expression
16328059 Observational study of gene-disease association. (HuGE Navigator)
16211278 Observational study of gene-disease association. (HuGE Navigator)
16194411 Observational study of gene-disease association. (HuGE Navigator)
16012746 Observational study of gene-disease association. (HuGE Navigator)
16012746 Data suggest that the DNMT3B TT genotype may be associated with an increased risk of prostate cancer.
16004934 involvement of HPV infection in nonsmoking female lung tumorigenesis may be mediated, at least to a certain extent, through the increase of DNMT3b protein expression to cause p16INK4a promoter hypermethylation
15962389 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15962389 The distribution of DNMT3B SNP in North China is distinct from that in Caucasians, but it cannot be used as a stratification marker to predict susceptibility and lymphatic metastasis of gasstric cardia adenocarcinoma.
15854647 DNMT3B was shown to have a very pronounced flanking sequence preference for human DNA methylation.
15580563 two types of ICF patients that harbor different genetic characteristics; ICF type 1 is characterized by DNMT3B mutations and normal methylation of the alpha satellites; Type 2 lacks DNMT3B mutations and shows hypomethylation of the alpha satellites.
15528220 Observational study of gene-disease association. (HuGE Navigator)
15528220 The DNMT3B -283T > C polymorphism influences DNMT3B expression, thus contributing to the genetic susceptibility to lung cancer.
15490234 Overexpression of DNMT3b4 is involved in human hepatocarcinogenesis, even at the precancerous stages, not only by inducing chromosomal instability but also by affecting the expression of specific genes
15467427 Down regulation of DNMT3b is associated with B-cell chronic lymphocytic leukemia
15375549 The DNMT3B C46359T polymorphism is statistically significantly associated with survival outcome in HNSCC patients.
15217506 Observational study of gene-disease association. (HuGE Navigator)
15148359 DNMT3B co-purifies and interacts, both in vivo and in vitro, with several components of the condensin complex (hCAP-C, hCAP-E and hCAP-G) and KIF4A
14559786 DNMT1 plays a key role in methylation maintenance, DNMT3b may act as an accessory to support the function in ovarian cancer cells.
14555514 Overexpression of DNMT3B is associated with breast tumor
12925568 DNMT3B is required for the methylation of L1 CpG islands on the inactive X chromosome.
12879017 DNMT3b plays an important role in neoplastic transformation
12738984 Over-expressed in squamous cell carcinoma of the mouth.
12601140 a registry of all known ICF-causing mutations, DNMT3Bbase, was constructed. The structural principles of the pathogenic mutations based on the modelled structure and the analysis of chi angle rotation changes of mutated side chains are discussed.
12359337 cloned and characterized the 5'-end of the mRNA and promoter regions
12208751 Observational study of gene-disease association. (HuGE Navigator)
12208751 The DNMT3B C46359T polymorphism is associated with promoter activity of a novel DNMT3B transcript, and associated with the risk of lung cancer in non-Hispanic whites.
12145218 the human de novo enzymes hDNMT3a and hDNMT3b form complexes with the major maintenance enzyme hDNMT1.
12110732 Overexpression of a splice variant is associated with DNA hypomethylation on pericentromeric satellite regions during human hepatocarcinogenesis
12015329 An essential role in cancer cell survival
11932749 DNMT1 and DNMT3b cooperate to silence genes in human cancer cells

AA Sequence

MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL      1 - 70
TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF     71 - 140
PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG    141 - 210
DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL    211 - 280
GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP    281 - 350
NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM    351 - 420
ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC    421 - 490
SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA    491 - 560
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN    561 - 630
ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV    631 - 700
AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK    701 - 770
VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR    771 - 840
HLFAPLKDYFACE                                                             841 - 853
//

Text Mined References (277)

PMID Year Title
27062459 2016 Genetic and epigenetic variation in the DNMT3B and MTHFR genes and colorectal adenoma risk.
26892683 2016 Expression of DNA methyltransferases 1 and 3B correlates with EZH2 and this 3-marker epigenetic signature predicts outcome in glioblastomas.
26729896 2016 Increased DNA methylation of Dnmt3b targets impairs leukemogenesis.
26667181 2015 A comprehensive analysis of radiosensitization targets; functional inhibition of DNA methyltransferase 3B radiosensitizes by disrupting DNA damage regulation.
26629529 2015 ? DNMT3B4-del Contributes to Aberrant DNA Methylation Patterns in Lung Tumorigenesis.
26573490 2016 Hepatitis B virus X protein upregulates DNA methyltransferase 3A/3B and enhances SOCS-1CpG island methylation.
26556862 2016 MiR-221 promotes stemness of breast cancer cells by targeting DNMT3b.
26505438 2015 DNA methyltransferase 3B -149C/T polymorphism and the risk of laryngeal squamous cell carcinoma: a case-control study.
26497367 2015 miR-124 and miR-506 inhibit colorectal cancer progression by targeting DNMT3B and DNMT1.
26485042 2015 Gene-specific DNA methylation of DNMT3B and MTHFR and colorectal adenoma risk.
26416384 2015 Association of DNA methyltransferases expression with global and gene-specific DNA methylation in colorectal cancer cells.
26406961 2015 Quantitative assessment of the association between DNMT3B-579G>T polymorphism and cancer risk.
26305882 2015 Methyltransferase expression and tumor suppressor gene methylation in sporadic and familial colorectal cancer.
26262893 2015 Polymorphism of DNA Methyltransferase 3b and Association with Development and Prognosis in Gastric Cancer.
26239024 2015 Aberrant expression and localization of deoxyribonucleic acid methyltransferase 3B in endometriotic stromal cells.
26098813 2015 Local chromatin microenvironment determines DNMT activity: from DNA methyltransferase to DNA demethylase or DNA dehydroxymethylase.
25899090 2015 Hypermethylation of glucocorticoid receptor gene promoter results in glucocorticoid receptor gene low expression in peripheral blood mononuclear cells of patients with systemic lupus erythematosus.
25822089 2015 Targeted disruption of DNMT1, DNMT3A and DNMT3B in human embryonic stem cells.
25815896 2015 DNA methyltransferase 3, a target of microRNA-29c, contributes to neuronal proliferation by regulating the expression of brain-derived neurotrophic factor.
25769449 2015 DNMT3b -149C/T promoter variants and methylation of colorectal cancer-associated genes.
25749421 2015 A feedback regulation between miR-145 and DNA methyltransferase 3b in prostate cancer cell and their responses to irradiation.
25746661 2015 Deregulation of DNMT1, DNMT3B and miR-29s in Burkitt lymphoma suggests novel contribution for disease pathogenesis.
25656965 2015 Maternal risk for down syndrome and polymorphisms in the promoter region of the DNMT3B gene: a case-control study.
25607950 2015 DNMT3B7 expression promotes tumor progression to a more aggressive phenotype in breast cancer cells.
25550796 2014 Expression profiling and clinicopathological significance of DNA methyltransferase 1, 3A and 3B in sporadic human renal cell carcinoma.
25530201 2015 Polymorphic variation in the epigenetic gene DNMT3B modulates the environmental impact on cognitive ability: a twin study.
25515408 2015 Systematic evaluation of cancer risk associated with DNMT3B polymorphisms.
25452147 2015 Global changes in DNA methylation in Alzheimer's disease peripheral blood mononuclear cells.
25433949 2015 Polymorphism of DNA methyltransferase 3B -149C/T and cancer risk: a meta-analysis.
25420499 2015 Mechanistic and biological significance of DNA methyltransferase 1 upregulated by growth factors in human hepatocellular carcinoma.
25392095 2014 Osteogenesis of umbilical mesenchymal stem cells is enhanced in absence of DNA methyltransferase 3B (DNMT3B) through upregulating Runx2 expression.
25204569 2015 Prognostic and biologic significance of DNMT3B expression in older patients with cytogenetically normal primary acute myeloid leukemia.
25126948 2014 Association of DNA methyltransferases 3A and 3B polymorphisms, and plasma folate levels with the risk of urothelial carcinoma.
25122426 2014 DNMT3B overexpression by deregulation of FOXO3a-mediated transcription repression and MDM2 overexpression in lung cancer.
25083817 2014 High DNA-methyltransferase 3B expression predicts poor outcome in acute myeloid leukemia, especially among patients with co-occurring NPM1 and FLT3 mutations.
25038421 2014 DNA methyltransferase haplotype is associated with Alzheimer's disease.
25027325 2014 Selective demethylation and altered gene expression are associated with ICF syndrome in human-induced pluripotent stem cells and mesenchymal stem cells.
24952347 2014 DNMT3L interacts with transcription factors to target DNMT3L/DNMT3B to specific DNA sequences: role of the DNMT3L/DNMT3B/p65-NF?B complex in the (de-)methylation of TRAF1.
24859147 2014 DNA methyl transferase (DNMT) gene polymorphisms could be a primary event in epigenetic susceptibility to schizophrenia.
24625449 2014 Significance of DNMT3b in oral cancer.
24603304 2014 Aza-deoxycytidine induces apoptosis or differentiation via DNMT3B and targets embryonal carcinoma cells but not their differentiated derivatives.
24577265 2014 Involvement of DNMT3B in the pathogenesis of Hirschsprung disease and its possible role as a regulator of neurogenesis in the human enteric nervous system.
24469050 2015 Global identification of genes targeted by DNMT3b for epigenetic silencing in lung cancer.
24459426 2013 Association of self-DNA mediated TLR9-related gene, DNA methyltransferase, and cytokeratin protein expression alterations in HT29-cells to DNA fragment length and methylation status.
24457336 2014 Expression of myeloperoxidase in acute myeloid leukemia blasts mirrors the distinct DNA methylation pattern involving the downregulation of DNA methyltransferase DNMT3B.
24362509 2014 DNMT3B C46359T and SHMT1 C1420T polymorphisms in the folate pathway in carcinogenesis of head and neck.
24343426 2014 Expression, regulation and roles of miR-26a and MEG3 in tongue squamous cell carcinoma.
24333507 2014 DNMT3B inhibits the re-expression of genes associated with induced pluripotency.
24316981 2014 Fusion of TTYH1 with the C19MC microRNA cluster drives expression of a brain-specific DNMT3B isoform in the embryonal brain tumor ETMR.
24260492 2013 Association of the DNMT3B -579G>T polymorphism with risk of thymomas in patients with myasthenia gravis.
24201117 2013 HIV infection of human regulatory T cells downregulates Foxp3 expression by increasing DNMT3b levels and DNA methylation in the FOXP3 gene.
24178910 2014 Genetic polymorphism of DNA methyltransferase 3B 149 C>T and risk of colorectal cancer: a meta-analysis.
24127215 2013 DNA methyltransferase-3-dependent nonrandom template segregation in differentiating embryonic stem cells.
24098518 2013 Influence of DNMT genotype on global and site specific DNA methylation patterns in neonates and pregnant women.
24094886 2013 DNMT3B7 expression related to MENT expression and its promoter methylation in human lymphomas.
24074865 2013 Dnmt3L antagonizes DNA methylation at bivalent promoters and favors DNA methylation at gene bodies in ESCs.
24069326 2013 Association between DNA methyltransferases 3B gene polymorphisms and the susceptibility to acute myeloid leukemia in Chinese Han population.
24028770 2013 PU.1 target genes undergo Tet2-coupled demethylation and DNMT3b-mediated methylation in monocyte-to-osteoclast differentiation.
24001151 2013 Mahanine restores RASSF1A expression by down-regulating DNMT1 and DNMT3B in prostate cancer cells.
23894490 2013 Inactive DNMT3B splice variants modulate de novo DNA methylation.
23820632 2013 Association between mRNA levels of DNMT1, DNMT3A, DNMT3B, MBD2 and LINE-1 methylation status in infants with tetralogy of Fallot.
23677709 2013 The 46359CT polymorphism of DNMT3B is associated with the risk of cervical cancer.
23636939 2013 Splice variants DNMT3B4 and DNMT3B7 overexpression inhibit cell proliferation in 293A cell line.
23545144 2013 DNA methyltransferases 1 and 3B are required for hepatitis C virus infection in cell culture.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
23486536 2013 Heterogeneous clinical presentation in ICF syndrome: correlation with underlying gene defects.
23393137 2013 DNA 5-methylcytosine demethylation activities of the mammalian DNA methyltransferases.
23251566 2012 High DNA methyltransferase DNMT3B levels: a poor prognostic marker in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23100393 2012 DNA-demethylating and anti-tumor activity of synthetic miR-29b mimics in multiple myeloma.
23081874 2013 DNMT3B promoter polymorphisms and maternal risk of birth of a child with Down syndrome.
23079992 2012 Association of DNMT1 and DNMT3B polymorphisms with breast cancer risk in Han Chinese women from South China.
23049596 2012 DNA methyltransferase 3B gene promoter and interleukin-1 receptor antagonist polymorphisms in childhood immune thrombocytopenia.
23039890 2012 Association of polymorphisms in DNMT1, DNMT3A, DNMT3B, MTHFR and MTRR genes with global DNA methylation levels and prognosis of autoimmune thyroid disease.
23025623 2013 Genetic variation in DNMT3B and increased global DNA methylation is associated with suicide attempts in psychiatric patients.
23000068 2012 DNA methyltransferase 3B (DNMT3B -579G>T) promotor polymorphism and the susceptibility to pediatric immune thrombocytopenic purpura in Egypt.
22898819 2012 The mammalian de novo DNA methyltransferases DNMT3A and DNMT3B are also DNA 5-hydroxymethylcytosine dehydroxymethylases.
22885766 2012 DNMT3B promoter polymorphism and risk of immune thrombocytopenic purpura in pediatric Egyptians.
22815530 2012 Truncated DNMT3B isoform DNMT3B7 suppresses growth, induces differentiation, and alters DNA methylation in human neuroblastoma.
22810147 2012 DNA methyltransferase 3b (DNMT3b), tumor tissue DNA methylation, Gleason score, and prostate cancer mortality: investigating causal relationships.
22768205 2012 Clinicopathological significance and prognostic value of DNA methyltransferase 1, 3a, and 3b expressions in sporadic epithelial ovarian cancer.
22664488 2012 Loss of post-transcriptional regulation of DNMT3b by microRNAs: a possible molecular mechanism for the hypermethylation defect observed in a subset of breast cancer cell lines.
22572543 2012 Aberrant immunoreactivity of deoxyribonucleic acid methyltransferases in adenomyosis.
22563479 2012 Antiproliferative effects of DNA methyltransferase 3B depletion are not associated with DNA demethylation.
22547080 2012 Pregnancy and the methyltransferase genotype independently influence the arsenic methylation phenotype.
22520950 2012 Clinicopathologic significance of DNA methyltransferase 1, 3a, and 3b overexpression in Tunisian breast cancers.
22490141 2012 [Correlation between polymorphism in the promoter of DNA methyltransferase-3B and the risk of colorectal cancer].
22394436 2012 DNA methyltransferase 3B expression is associated with poor outcome of stage I testicular seminoma.
22378288 2012 DNA replication is altered in Immunodeficiency Centromeric instability Facial anomalies (ICF) cells carrying DNMT3B mutations.
22349384 2012 [Expression of DNMT1, DNMT3a, and DNMT3b in eutopic endometrium].
22301400 2012 Association of increased DNA methyltransferase expression with carcinogenesis and poor prognosis in pancreatic ductal adenocarcinoma.
22272627 2012 DNMT3B promoter polymorphisms and risk of late onset Alzheimer's disease.
22244828 2012 A DNA methylation signature associated with aberrant promoter DNA hypermethylation of DNMT3B in human colorectal cancer.
22236544 2012 DNMT3B (C46359T) polymorphisms and immunoexpression of DNMT3b and DNMT1 proteins in oral lichen planus.
22207353 2012 Role of DNMT3B in the regulation of early neural and neural crest specifiers.
22094255 2011 Oxidative damage targets complexes containing DNA methyltransferases, SIRT1, and polycomb members to promoter CpG Islands.
22072770 2012 Contributions of CTCF and DNA methyltransferases DNMT1 and DNMT3B to Epstein-Barr virus restricted latency.
22056872 2012 Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-?.
22048249 2011 DNA methylation imprinting marks and DNA methyltransferase expression in human spermatogenic cell stages.
22009713 2012 Genetic sequence variants and the development of secondary primary cancers in patients with head and neck cancers.
21938431 2012 DNMT3B polymorphisms and cancer risk: a meta analysis of 24 case-control studies.
21909138 2012 MTSS1, a novel target of DNA methyltransferase 3B, functions as a tumor suppressor in hepatocellular carcinoma.
21887463 2012 Transcriptional analysis of CXCR4, DNMT3A, DNMT3B and DNMT1 gene expression in primary advanced uterine cervical carcinoma.
21854760 2011 Transcriptional activity of DNMT3B in pancreatic cancer cells: effects of -149 (C?T) promoter polymorphism.
21757290 2011 Hepatitis C virus Core protein stimulates cell growth by down-regulating p16 expression via DNA methylation.
21720545 2011 Structural and histone binding ability characterizations of human PWWP domains.
21712824 2011 Methylator phenotype of malignant germ cell tumours in children identifies strong candidates for chemotherapy resistance.
21698279 2011 A DNMT3B alternatively spliced exon and encoded peptide are novel biomarkers of human pluripotent stem cells.
21592522 2011 State-dependent changes in the expression of DNA methyltransferases in mood disorder patients.
21559330 2011 Heterochromatic genes undergo epigenetic changes and escape silencing in immunodeficiency, centromeric instability, facial anomalies (ICF) syndrome.
21549127 2011 ICF syndrome mutations cause a broad spectrum of biochemical defects in DNMT3B-mediated de novo DNA methylation.
21521786 2011 DNA methylation profiling reveals novel biomarkers and important roles for DNA methyltransferases in prostate cancer.
21519807 2011 Genetic variation in the promoter of DNMT3B is associated with the risk of colorectal cancer.
21490393 2011 Genes methylated by DNA methyltransferase 3b are similar in mouse intestine and human colon cancer.
21482616 2011 Reduced expression of DNMT3B in the germ cells of patients with bilateral spermatogenic arrest does not lead to changes in the global methylation status.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21304883 2011 Nucleosomes containing methylated DNA stabilize DNA methyltransferases 3A/3B and ensure faithful epigenetic inheritance.
21229291 2011 Epigenetic regulation of DNA methyltransferases: DNMT1 and DNMT3B in gliomas.
21211326 2010 [Gene-gene interaction between DNMT3B and DRD1 in schizophrenia].
21154337 2010 [Association of DNA methyltransferase 3B gene polymorphism with early-onset schizophrenia].
21106767 2010 Developing multidrug-resistant cells and exploring correlation between BCRP/ABCG2 over-expression and DNA methyltransferase.
21081840 2011 Downregulation of microRNA-29c is associated with hypermethylation of tumor-related genes and disease outcome in cutaneous melanoma.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20980350 2011 Effects of specific DNMT gene depletion on cancer cell transformation and breast cancer cell invasion; toward selective DNMT inhibitors.
20970125 2011 Expression and regulation of DNA methyltransferases in human endometrium.
20960050 2011 Dietary methyl donors, methyl metabolizing enzymes, and epigenetic regulators: diet-gene interactions and promoter CpG island hypermethylation in colorectal cancer.
20952535 2010 Interaction of noncoding RNA with the rDNA promoter mediates recruitment of DNMT3b and silencing of rRNA genes.
20838592 2010 DNMT3L modulates significant and distinct flanking sequence preference for DNA methylation by DNMT3A and DNMT3B in vivo.
20833755 2010 Nanaomycin A selectively inhibits DNMT3B and reactivates silenced tumor suppressor genes in human cancer cells.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20593030 2010 Human intelligence and polymorphisms in the DNA methyltransferase genes involved in epigenetic marking.
20514408 2010 Effect of age on the association between p16CDKN2A methylation and DNMT3B polymorphism in head and neck carcinoma and patient survival.
20506537 2010 Transcriptional and post-transcriptional control of DNA methyltransferase 3B is regulated by phosphatidylinositol 3 kinase/Akt pathway in human hepatocellular carcinoma cell lines.
20480259 2010 DNMT3B -579 G>T promoter polymorphism and risk of gallbladder carcinoma in North Indian population.
20454457 2010 HOXB13, a target of DNMT3B, is methylated at an upstream CpG island, and functions as a tumor suppressor in primary colorectal tumors.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20448464 2010 Epigenetic alteration of microRNAs in DNMT3B-mutated patients of ICF syndrome.
20428781 2010 DNA methyltransferase 3-like affects promoter methylation of thymine DNA glycosylase independently of DNMT1 and DNMT3B in cancer cells.
20426865 2010 Benzo[a]pyrene diol epoxide suppresses retinoic acid receptor-beta2 expression by recruiting DNA (cytosine-5-)-methyltransferase 3A.
20398055 2010 DNMT1 and DNMT3b silencing sensitizes human hepatoma cells to TRAIL-mediated apoptosis via up-regulation of TRAIL-R2/DR5 and caspase-8.
20398054 2010 DNA methyltransferase DNMT3b protein overexpression as a prognostic factor in patients with diffuse large B-cell lymphomas.
20381446 2010 Polymorphisms in methyl-group metabolism genes and risk of sporadic colorectal cancer with relation to the CpG island methylator phenotype.
20381114 2010 DNA methyltransferases 1, 3a, and 3b overexpression and clinical significance in gastroenteropancreatic neuroendocrine tumors.
20375073 2010 Modulation of E-cadherin expression by K-Ras; involvement of DNA methyltransferase-3b.
20127025 2010 Expression pattern and clinical significance of DNA methyltransferase 3B variants in gastric carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19932585 2010 Increased CXCR4 expression in AsPC1 pancreatic carcinoma cells with RNA interference-mediated knockdown of DNMT1 and DNMT3B.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19854132 2009 Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.
19843671 2009 Genetic variants of methyl metabolizing enzymes and epigenetic regulators: associations with promoter CpG island hypermethylation in colorectal cancer.
19825994 2009 A novel DNMT3B splice variant expressed in tumor and pluripotent cells modulates genomic DNA methylation patterns and displays altered DNA binding.
19798569 2010 Two-stage case-control study of DNMT-1 and DNMT-3B gene variants and breast cancer risk.
19798101 2009 Np95 interacts with de novo DNA methyltransferases, Dnmt3a and Dnmt3b, and mediates epigenetic silencing of the viral CMV promoter in embryonic stem cells.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786833 2009 Dnmt3/transcription factor interactions as crucial players in targeted DNA methylation.
19777235 2010 The -283C/T polymorphism of the DNMT3B gene influences the progression of joint destruction in rheumatoid arthritis.
19763880 2010 DNA methyltransferase expression differs with proliferation in childhood acute lymphoblastic leukemia.
19696477 2009 DNMT3B 579G>T promoter polymorphism and the risk for idiopathic thrombocytopenic purpura in a Chinese population.
19680556 2009 Genetic variation in healthy oldest-old.
19626461 2010 Association of the DNMT3B polymorphism with colorectal adenomatous polyps and adenocarcinoma.
19620278 2009 Selective anchoring of DNA methyltransferases 3A and 3B to nucleosomes containing methylated DNA.
19576953 2009 DNA methyltransferase 3B gene increases risk of early onset schizophrenia.
19517237 2010 DNMT3B promoter polymorphism and risk of gastric cancer.
19502167 2009 Influence of DNA methyltransferase 3b on FHIT expression and DNA methylation of the FHIT promoter region in hepatoma SMMC-7721 cells.
19482874 2009 DNMT3B interacts with constitutive centromere protein CENP-C to modulate DNA methylation and the histone code at centromeric regions.
19470733 2009 DNMT3B expression might contribute to CpG island methylator phenotype in colorectal cancer.
19465937 2009 DNA methyltransferase-mediated transcriptional silencing in malignant glioma: a combined whole-genome microarray and promoter array analysis.
19465161 2009 Single nucleotide polymorphism in DNMT3B promoter and its association with hepatocellular carcinoma in a Moroccan population.
19451595 2009 Folate supplementation limits the aggressiveness of glioma via the remethylation of DNA repeats element and genes governing apoptosis and proliferation.
19399408 2009 Effects on biological behavior of bladder carcinoma T24 cells via silencing DNMT1 and/or DNMT3b with shRNA in vitro.
19326430 2009 The MTHFR C677T and DeltaDNMT3B C-149T polymorphisms confer different risks for right- and left-sided colorectal cancer.
19246518 2009 A systematic search for DNA methyltransferase polymorphisms reveals a rare DNMT3L variant associated with subtelomeric hypomethylation.
19211935 2009 MicroRNA-29b induces global DNA hypomethylation and tumor suppressor gene reexpression in acute myeloid leukemia by targeting directly DNMT3A and 3B and indirectly DNMT1.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19107573 2009 Estrogen regulates DNA methyltransferase 3B expression in Ishikawa endometrial adenocarcinoma cells.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19024105 2008 Critical role of deltaDNMT3B4/2 in regulating RASSF1A promoter-specific DNA methylation in non-small cell lung cancer.
19019622 2009 Down-regulation of CXCR4 expression by tamoxifen is associated with DNA methyltransferase 3B up-regulation in MCF-7 breast cancer cells.
18829110 2009 Aberrant promotor methylation in MDS hematopoietic cells during in vitro lineage specific differentiation is differently associated with DNMT isoforms.
18762900 2008 DNA methyltransferase 3B mutant in ICF syndrome interacts non-covalently with SUMO-1.
18683034 2008 Decreased DNA methyltransferase 3A and 3B mRNA expression in peripheral blood mononuclear cells and increased plasma SAH concentration in adult patients with idiopathic thrombocytopenic purpura.
18662374 2008 Promoter polymorphisms of DNMT3B and the risk of colorectal cancer in Chinese: a case-control study.
18639864 2008 GABAA receptor promoter hypermethylation in suicide brain: implications for the involvement of epigenetic processes.
18567530 2008 DNA methyltransferase 3B acts as a co-repressor of the human polycomb protein hPc2 to repress fibroblast growth factor receptor 3 transcription.
18563322 2008 Suppressing effects of down-regulating DNMT1 and DNMT3b expression on the growth of human cholangiocarcinoma cell line.
18544619 2008 Deoxyribonucleic acid methyltransferase 3B promotes epigenetic silencing through histone 3 chromatin modifications in pituitary cells.
18499700 2008 Haplotypes of DNMT1 and DNMT3B are associated with mutagen sensitivity induced by benzo[a]pyrene diol epoxide among smokers.
18455294 2008 Polymorphisms of the DNMT3B gene and risk of squamous cell carcinoma of the head and neck: a case-control study.
18452947 2008 Characterization of Dnmt3b:thymine-DNA glycosylase interaction and stimulation of thymine glycosylase-mediated repair by DNA methyltransferase(s) and RNA.
18437543 2008 Single nucleotide polymorphism in DNMT3B promoter and the risk for idiopathic thrombocytopenic purpura in Chinese population.
18414412 2008 Expression of methylation-related genes is associated with overall survival in patients with non-small cell lung cancer.
18413740 2008 DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation.
18407600 2008 DNMT3B 579 G>T promoter polymorphism and risk of esophagus carcinoma in Chinese.
18367714 2008 miR-148 targets human DNMT3b protein coding region.
18336997 2008 The -149C>T SNP within the DeltaDNMT3B gene, is not associated with early disease onset in hereditary non-polyposis colorectal cancer.
18268116 2008 DNA methyltransferase and alcohol dehydrogenase: gene-nutrient interactions in relation to risk of colorectal polyps.
18253830 2008 The expression and clinical significance of DNA methyltransferase proteins in human gastric cancer.
18221536 2008 DNMT3b overexpression contributes to a hypermethylator phenotype in human breast cancer cell lines.
18097598 2008 Gene expression and promoter polymorphisms of DNA methyltransferase 3B in nasopharyngeal carcinomas in Taiwanese people: a case-control study.
18029387 2008 DNA methyltransferase 3B (DNMT3B) mutations in ICF syndrome lead to altered epigenetic modifications and aberrant expression of genes regulating development, neurogenesis and immune function.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023104 2007 DNA methyltransferase 3B promoter polymorphism and its susceptibility to primary hepatocellular carcinoma in the Chinese Han nationality population: a case-control study.
18006804 2007 Delta DNMT3B variants regulate DNA methylation in a promoter-specific manner.
17998942 2008 DNMT3A and DNMT3B mediate autocrine hGH repression of plakoglobin gene transcription and consequent phenotypic conversion of mammary carcinoma cells.
17991895 2008 DNA methylation inhibitor 5-Aza-2'-deoxycytidine induces reversible genome-wide DNA damage that is distinctly influenced by DNA methyltransferases 1 and 3B.
17890317 2007 MicroRNA-29 family reverts aberrant methylation in lung cancer by targeting DNA methyltransferases 3A and 3B.
17705213 2007 Early prenatal diagnosis of ICF syndrome by mutation detection.
17688412 2007 Homocysteine-mediated expression of SAHH, DNMTs, MBD2, and DNA hypomethylation potential pathogenic mechanism in VSMCs.
17538945 2007 Progressive up-regulation of genes encoding DNA methyltransferases in the colorectal adenoma-carcinoma sequence.
17532557 2007 RNA interference-mediated knockdown of DNMT1 and DNMT3B induces CXCL12 expression in MCF-7 breast cancer and AsPC1 pancreatic carcinoma cell lines.
17369845 2007 Cigarette smoke induces demethylation of prometastatic oncogene synuclein-gamma in lung cancer cells by downregulation of DNMT3B.
17353906 2007 Cancer cells express aberrant DNMT3B transcripts encoding truncated proteins.
17318376 2007 DNMT3b 39179GT polymorphism and the risk of adenocarcinoma of the colon in Koreans.
17303076 2007 Zinc-fingers and homeoboxes 1 (ZHX1) binds DNA methyltransferase (DNMT) 3B to enhance DNMT3B-mediated transcriptional repression.
17277043 2007 Associations of MTHFR DNMT3b 4977 bp deletion in mtDNA and GSTM1 deletion, and aberrant CpG island hypermethylation of GSTM1 in non-obstructive infertility in Indian men.
17200670 2007 Polycomb-mediated methylation on Lys27 of histone H3 pre-marks genes for de novo methylation in cancer.
17149367 2006 Hypermethylation of the p16 gene promoter in pterygia and its association with the expression of DNA methyltransferase 3b.
17081533 2007 Aberrant expression of deoxyribonucleic acid methyltransferases DNMT1, DNMT3A, and DNMT3B in women with endometriosis.
17067458 2006 [Expression of DNA methyltransferases in salivary adenoid cystic carcinoma and its association with the CpG islands methylation of tumor suppressor genes].
17017004 2006 Lower expression of p14ARF and p16INK4a correlates with higher DNMT3B expression in human oesophageal squamous cell carcinomas.
16951151 2006 Silencing of the metastasis suppressor RECK by RAS oncogene is mediated by DNA methyltransferase 3b-induced promoter methylation.
16951144 2006 Expression of Delta DNMT3B variants and its association with promoter methylation of p16 and RASSF1A in primary non-small cell lung cancer.
16920385 2007 Promoter polymorphisms of DNMT3B and the risk of head and neck squamous cell carcinoma in Taiwan: a case-control study.
16773201 2006 A novel DNMT3B subfamily, DeltaDNMT3B, is the predominant form of DNMT3B in non-small cell lung cancer.
16682412 2006 The histone methyltransferase SETDB1 and the DNA methyltransferase DNMT3A interact directly and localize to promoters silenced in cancer cells.
16543361 2006 Mutations in DNA methyltransferase DNMT3B in ICF syndrome affect its regulation by DNMT3L.
16501248 2006 Genetic variants in epigenetic genes and breast cancer risk.
16501171 2006 Roles for Dnmt3b in mammalian development: a mouse model for the ICF syndrome.
16481298 2006 Effect of antisense DNMT3b gene eukaryotic expression plasmid on expression of the DNMT3b gene in human biliary tract carcinoma cells.
16463117 2006 Lowered DNA methyltransferase (DNMT-3b) mRNA expression is associated with genomic DNA hypermethylation in patients with chronic alcoholism.
16357870 2006 The Polycomb group protein EZH2 directly controls DNA methylation.
16328059 2006 Germ-line variants in methyl-group metabolism genes and susceptibility to DNA methylation in human breast cancer.
16211278 2005 No evidence of correlation between the single nucleotide polymorphism of DNMT3B promoter and gastric cancer risk in a Japanese population.
16194411 2005 [The C46359T polymorphism of DNMT3B promoter gene and pathogenesis of acute leukemia].
16012746 2005 Polymorphisms in the DNA methyltransferase 3b gene and prostate cancer risk.
16004934 2005 An association of DNMT3b protein expression with P16INK4a promoter hypermethylation in non-smoking female lung cancer with human papillomavirus infection.
15962389 2005 Single nucleotide polymorphism in DNA methyltransferase 3B promoter and its association with gastric cardiac adenocarcinoma in North China.
15854647 2005 Profound flanking sequence preference of Dnmt3a and Dnmt3b mammalian DNA methyltransferases shape the human epigenome.
15721400 2005 Opposite alterations of DNA methyltransferase gene expression in endometrioid and serous endometrial cancers.
15580563 2005 DNMT3B mutations and DNA methylation defect define two types of ICF syndrome.
15528220 2005 DNMT3B polymorphisms and risk of primary lung cancer.
15490234 2004 Alterations in gene expression associated with the overexpression of a splice variant of DNA methyltransferase 3b, DNMT3b4, during human hepatocarcinogenesis.
15467427 2004 Expression analysis of the epigenetic methyltransferases and methyl-CpG binding protein families in the normal B-cell and B-cell chronic lymphocytic leukemia (CLL).
15375549 2004 A novel C/T polymorphism in the core promoter of human de novo cytosine DNA methyltransferase 3B6 is associated with prognosis in head and neck cancer.
15217506 2004 The DNMT3B C-->T promoter polymorphism and risk of breast cancer in a British population: a case-control study.
15148359 2004 Isolation and characterization of a novel DNA methyltransferase complex linking DNMT3B with components of the mitotic chromosome condensation machinery.
15120635 2004 DNMT3B interacts with hSNF2H chromatin remodeling enzyme, HDACs 1 and 2, and components of the histone methylation system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559786 2003 Double RNA interference of DNMT3b and DNMT1 enhances DNA demethylation and gene reactivation.
14555514 2003 Expression analysis of DNA methyltransferases 1, 3A, and 3B in sporadic breast carcinomas.
12925568 2003 X inactivation-specific methylation of LINE-1 elements by DNMT3B: implications for the Lyon repeat hypothesis.
12879017 2003 DNA methyltransferase 3b contributes to oncogenic transformation induced by SV40T antigen and activated Ras.
12867029 2003 Suv39h-mediated histone H3 lysine 9 methylation directs DNA methylation to major satellite repeats at pericentric heterochromatin.
12738984 2003 Over-expression of DNA methyltransferases and CDKN2A gene methylation status in squamous cell carcinoma of the oral cavity.
12601140 2002 Structural basis of ICF-causing mutations in the methyltransferase domain of DNMT3B.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359337 2002 The human DNA methyltransferases DNMT3A and DNMT3B have two types of promoters with different CpG contents.
12239717 2002 Three novel DNMT3B mutations in Japanese patients with ICF syndrome.
12208751 2002 A novel polymorphism in human cytosine DNA-methyltransferase-3B promoter is associated with an increased risk of lung cancer.
12202768 2002 Dnmt3L is a transcriptional repressor that recruits histone deacetylase.
12145218 2002 Co-operation and communication between the human maintenance and de novo DNA (cytosine-5) methyltransferases.
12110732 2002 Overexpression of a splice variant of DNA methyltransferase 3b, DNMT3b4, associated with DNA hypomethylation on pericentromeric satellite regions during human hepatocarcinogenesis.
12015329 2002 An essential role for DNA methyltransferase DNMT3B in cancer cell survival.
11934864 2002 Dnmt3L cooperates with the Dnmt3 family of de novo DNA methyltransferases to establish maternal imprints in mice.
11932749 2002 DNMT1 and DNMT3b cooperate to silence genes in human cancer cells.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11735126 2001 Dnmt3b, de novo DNA methyltransferase, interacts with SUMO-1 and Ubc9 through its N-terminal region and is subject to modification by SUMO-1.
11350943 2001 Dnmt3a binds deacetylases and is recruited by a sequence-specific repressor to silence transcription.
11102980 2000 Genetic variation in ICF syndrome: evidence for genetic heterogeneity.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10647011 1999 Chromosome instability and immunodeficiency syndrome caused by mutations in a DNA methyltransferase gene.
10588719 1999 The DNMT3B DNA methyltransferase gene is mutated in the ICF immunodeficiency syndrome.
10555141 1999 DNA methyltransferases Dnmt3a and Dnmt3b are essential for de novo methylation and mammalian development.
10433969 1999 Cloning, expression and chromosome locations of the human DNMT3 gene family.
10325416 1999 The human DNA methyltransferases (DNMTs) 1, 3a and 3b: coordinate mRNA expression in normal tissues and overexpression in tumors.
9662389 1998 Cloning and characterization of a family of novel mammalian DNA (cytosine-5) methyltransferases.