Property Summary

NCBI Gene PubMed Count 403
PubMed Score 1415.15
PubTator Score 979.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.179 4.6e-03
malignant mesothelioma 1.200 3.3e-06
psoriasis 2.200 1.3e-04
astrocytoma 1.500 6.4e-03
juvenile dermatomyositis 1.545 2.6e-14
acute quadriplegic myopathy 1.051 3.1e-06
adrenocortical carcinoma 1.206 2.0e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.3e-02
group 3 medulloblastoma 1.100 2.7e-02
invasive ductal carcinoma 1.200 3.4e-03
ulcerative colitis 1.200 2.5e-06
ovarian cancer 2.100 6.0e-06
dermatomyositis 1.300 2.0e-04

Protein-protein Interaction (4)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
588458 screening 2975 / 0 / 356546 uHTS identification of DNMT1 inhibitors in a Fluorescent Molecular Beacon assay
588464 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of DNMT1
602385 screening 181 / 0 / 2072 Single concentration confirmation of DNMT1 inhibitors in a Fluorescent Molecular Beacon assay
602386 confirmatory 179 / 0 / 21 Dose response confirmation of DNMT1 inhibitors in a Fluorescent Molecular Beacon assay

Gene RIF (346)

PMID Text
27087738 Results show that polymorphisms of the DNMT1 gene may affect overall survival of Gastric Cancer (GC) Patients. The SNP rs2228611 has the potentiality to serve as an independent prognostic marker for GC patients.
27071379 Tumor expression of DNMT1 in breast cancer differed by molecular subtype and stromal histological type.
27021683 miR-140-5p at least partly targets Dnmt1 and regulates SOD2 expression to inhibit proliferation and promote apoptosis and differentiation of HPASMCs in hypoxia
26929335 The subangstrom geometric and electrostatic structure of the major transition state of the reaction catalyzed by human DNMT1 is presented. The rate-limiting methyl transfer occurs after Cys(1226) attack to Cyt C6.
26892683 Data indicate an epigenetic prognostic signature in glioblastomas based on expression of polycomb repressive complex 2 (EZH2), DNA-methyltransferases DNMT1 and 3B which can be used easily in routine neuropathology practice.
26815200 Endothelial-Mesenchymal Transition is initiated by recruitment of aberrantly phosphorylated DNMT1 to the RASAL1 CpG island promoter by HDAC2, causing aberrant promoter methylation and transcriptional suppression.
26782424 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.
26774342 We further demonstrate that such fibroblast activation is dependent on phosphate influx, aberrant phosphorylation of DNA methyltransferase DNMT1 and aberrant CpG island promoter methylation.
26676363 The inhibition of DNMT1 contributed to the activation of p53 pathways.
26602018 the abundance of BDNF positively correlated and phosphorylated DNMT1 inversely correlated with that of FKBP51 in cells
26530812 These data suggest that targeting the IL-8/AKT1 signaling pathway and DNMT1 may provide a potential therapeutic approach for blocking NPC metastasis.
26497367 miR-124 and miR-506 inhibit progression and increase sensitivity to chemotherapy by targeting DNMT3B and DNMT1 in colorectal carcinoma.
26454216 interaction between menin and Dnmt1 reversibly regulates pancreatic cancer cell growth downstream of Hedgehog pathways with complex mutual modulation networks.
26416384 To correlate DNMTs expression with DNA methylation, DNMT1, DNMT3A and DNMT3B mRNA levels in 5 colorectal cancer cell lines; results suggest that cellular DNMT expression is positively correlated with global DNA methylation level but not with regional DNA hypermethylation at each locus.
26362062 Overexpression of DNMT1 diminishes ursolic acid-reduced EZH2 protein expression.
26337869 The results showed that compared with parental U251 cells, DNMT1 expression was downregulated, miR-20a promoter methylation was attenuated and miR-20a levels were elevated in temozolomide -resistant U251 cells.
26333125 Treatment of Raji cells with curcumin (10 muM) for 6 days led to down-regulation of DNA methyltransferase 1. Curcumin- mediated reversal of p15 promoter methylation might be potentiated by down-regulation of DNA methyltransferase 1 expression.
26307088 results demonstrate that deregulation of DNMT1-associated long non-coding RNAs contribute to aberrant DNA methylation and gene expression during colon tumorigenesis
26305882 DNMT1, DNMT3B, and EZH2 were expressed at significantly higher levels in tumor vs. normal tissues.
26299326 Phosphorylated p38, DNMT1 and AChE were aberrantly expressed in a subset of hepatocellular carcinoma tumors.
26261487 DNMT1 overexpression was seen correlated with a reduction of MGMT protein expression in high grade astrocytic tumour.
26211580 DNMT1 rs11085721 polymorphism confers susceptibility to acute lymphoblastic leukemia in a Chinese population.
26162541 This is the first study to demonstrate a significant association between TNBC risk and the polymorphisms of EZH2 and DNMT1, and our researches indicate that the SNPs of EZH2 and DNMT1 are risk predictors for TNBC.
26139044 DNMT1 expression is positively correlated with body mass index.
26120002 found a direct correlation between DNMT1 hyperactivity and tumorous tissue.
26090723 DNMT1 has a role in suppressing microRNA424 regulation of tumor progression in human bladder cancer
26085088 These findings identify functional cross-talk between KIT and DNMT1 in the development of drug resistance, implying the reciprocal targeting of protein kinases and DNA methyltransferases as an essential strategy for durable responses in lung cancer.
26070743 The crystal structure provides a framework for understanding the functional consequence of disease-related hDNMT1 mutations.
26056945 results suggested that Piwil1 caused the loss of PTEN expression through DNMT1-mediated PTEN hypermethylation
25990724 The binding of miRNAs, such as miR-155-5p, leads to inhibition of DNMT1 enzyme activity.
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25960197 These studies reveal that USP7-mediated stabilization of DNMT1 is regulated by acetylation and provide a structural basis for the design of inhibitors.
25950085 Results show that: the expression level of miR-148a significantly decreased in pancreatic cancer tissues whereas that of DNMT1 increased; Mir-148a targets the promotor region DNMT1 and both of them are involved in pancreatic tumorigenesis.
25948775 This work strongly suggests that a direct pharmacological inhibition of DNMT1, unlike the use of 5-aza-2'-deoxycytidine, should lead to tumor suppressor gene hypomethylation and re-expression without inducing major DNA damage in leukemia.
25927928 miR-148b reverses cisplatin-resistance in non-small cell cancer cells via negatively regulating DNMT1 expression
25908435 Dnmt1 is indispensable for mammary cancer stem cell maintenance, and for mammary tumorigenesis. Dnmt1 hypermethylates and downregulates ISL1 in mammary tumors and cancer stem cells.
25899090 DNMT1 mRNA expression was significantly greater in patients with SLE compared to controls.
25892014 The hypermethylation of KLF4 directly mediated by Dnmt1 contributes to the progression of EMT in renal epithelial cells.
25888794 Validated DNMT1-targeted DNAzyme in its enzymatic and cellular activities. Transfection of the DNAzyme caused significant down-regulation of DNMT1 expression and reactivation of p16 gene, resulting in reduced cell proliferation of bladder cancers.
25886188 Hypermethylation of DNMT1 gene is associated with esophageal squamous cell carcinoma.
25865490 Results show that miR-148a is down-regulated in urothelial cell carcinoma of the bladder cell lines. Its overexpression leads to induction of apoptosis in part by down-regulating DNMT1.
25854163 MRTF-A and STAT3 synergistically recruited DNMT1 to hypermethylate the promoter of BRMS1 and affect the expression of BRSM1.
25822089 Repression of exogenous DNMT1 initiates rapid, global loss of DNA methylation, followed by extensive cell death.
25753001 Two critical oncoproteins, Dnmt1 and beta-catenin, mutually regulate each other's levels and activities in colorectal cancer cells.
25746661 The data suggest that deregulation of DNMT1, DNMT3B and miR29 may be involved in Burkitt lymphoma pathogenesis.
25738352 The increased expression of DNMT1, and the reduced expression of GSTP1 and APC have an important role in the development of prostate cancer .
25705251 HIV-1 Tat upregulates DNMT1, DNMT3A, and DNMT3B both at the mRNA and protein levels in primary tumors
25700986 methylation of SRD5A2 is regulated by DNA methyltransferase 1, and inflammatory mediators such as tumor necrosis factor alpha, NF-kappaB, and IL-6 regulate DNA methyltransferase 1 expression and thereby affect SRD5A2 promoter methylation and gene expression.
25678562 Mutations in DNMT1 result in imbalanced protein homeostasis through aggresome-induced autophagy.
25596970 DNMT1 polymorphisms might contribute to the risk of CHD, especially rs16999593 and rs2228612.
25595591 EZH2 and DNMT1-mediated epigenetic silencing contributed to the progression of gastric cancer and glioblastoma.
25550796 expression of DNMT1 was an independent prognostic factor for overall survival in renal cell carcinoma.
25547067 Ursolic acid induces phosphorylation of AMP-activated protein kinase alpha (AMPKalpha) and suppresses the protein expression of DNA methyltransferase 1 (DNMT1).
25512445 Our results suggest that a novel "DNMT1-miR-126 epigenetic circuit" is involved in esophageal squamous cell carcinoma progression
25476119 The expression (mRNA and protein levels) of DNMT1 and TET1 is increased in PFC of SZ and BP disorder patients.
25461380 Results from our study indicate that DNMT1 and 3b were overexpressed and could be involved in gastric tumorigenesis of intestinal histological type in the case of Tunisian patients.
25455074 RB maintains quiescence and prevents premature senescence through upregulation of DNMT1 in mesenchymal stromal cells
25452147 DNA hypermethylation in late onset Alzheimer's disease was paralleled by higher DNA methyltransferase 1 (DNMT1) gene expression and protein levels.
25451918 UHRF1 interacts with TopoIIalpha and regulates its localization to hemimethylated DNA. TopoIIalpha decatenates the hemimethylated DNA following replication, which might facilitate the methylation of the nascent strand by DNMT1
25444908 Study reveals a novel function of beta-Arrestin1 in the regulation of the self-renewal of leukemia initiating cells-enriched fraction from B-lineage acute lymphoblastic leukemia patients related to DNMT1 activity.
25420499 Analysis of DNA methylation in CpG islands of target genes revealed high co-localization of DNMT1 and DNMT3B on the promoters of TSGs associated with enhanced CpG hypermethylation
25389112 Results show that DNMT1 has a central role in C22orf2 and BCL2L11 promoter hyper-methylation, resulting in gene transcriptional down-modulation.
25378232 DNMT1 expression was upregulated by BRAF V600E induced NF-kappaB activation.
25349215 findings may offer a new approach for determination of molecular effects of Wnt/beta-catenin signal pathway on DNMT1
25319390 miR-185 suppresses tumor proliferation by directly targeting E2F6 and DNMT1 and indirectly upregulating BRCA1 in triple-negative breast cancer.
25315069 deltaEF1 associates with DNMT1 and maintains DNA methylation of the E-cadherin promoter in breast cancer cells.
25284287 BTG2 expression was inversely correlated with increased expression of the DNA methyltransferases DNMT1 and DNMT3a in MIBC, but not NMIBC, suggesting a potential role for BTG2 expression in muscle invasion of bladder cancer
25231260 High DNMT1 expression is associated with testicular germ cell tumor.
25207720 Luteolin induces UHRF1 and DNMT1 downregulation and stimulates p16INK4A reexpression in human colon cancer cell line BE.
25189999 By DNA methyltransferase 1 under regulation by Uhrf1.
25107489 The rate of gene promoter methylation of WNT pathway regulators is high in colorectal cancer cells. Hyper-methylation is associated with increased expression of the DNMT1 enzyme.
25038421 no significant difference between Alzheimer's disease and the control group were observed for DNMT1 polymorphisms
25033457 A novel insights into the epigenetic mechanism of neurodegeneration arising from a hotspot DNMT1 mutation and reveal pathways potentially important in a broad category of neurological and psychological disorders.
25015109 Studies identify nucleolin as an unconventional epigenetic regulator in leukemia cells and demonstrate nucleolin-NFkappaB-DNMT1 axis as a new molecular pathway underlying AML leukemogenesis.
25004396 There appeared to be a reciprocal regulatory relationship of miR-152/DNMT1 expression, as cells treated with siRNA DNMT1 caused miR-152 to be re-expressed in all cell lines.
24947242 suggest that targeting of the IL-6/JAK2/STAT3 signaling pathway and DNMT1 may become important strategies for treating lung cancer
24913034 miR-30b-5p is significantly diminished in gastric cancer tissues, providing the first insight into the epigenetic mechanism of miR-30b-5p down-regulation, induced by DNMT1, and the role of miR-30b-5p in gastric cancer carcinogenesis.
24911372 miR-185 inhibits Hepatocellular carcinoma cell growth by targeting DNMT1, leading to PTEN induction and Akt inhibition.
24875904 TNFalpha in the marrow microenvironment led to RANKL demethylation and re-expression in myeloma cells through DNMT1 repression and upregulation of miR-126-3p and miR-140, both known to repress DNMT1 translation.
24859147 DNMT1 rs2114724 (genotype P = .004, allele P = 0.022) and rs2228611 (genotype P = 0.004, allele P = 0.022) were found to be significantly associated at genotypic and allelic level with Schizophrenia in South Indian population.
24833086 LncRNA ADAMTS9-AS2 is regulated by DNMT1 and inhibits migration of glioma cells.
24714841 Results found that DNMT1 is aberrantly upregulated in hepatocellular carcinoma cell lines, and its overexpression is responsible for hypermethylation of the miR-148a promoter.
24675762 Kaposi's sarcoma-associated herpesvirus (KSHV) vIL-6 promotes cell proliferation and migration by upregulating DNMT1 via STAT3 activation.
24637615 The global DNA hypomethylation induced by the DNMT1/PCNA/UHRF1 disruption is an oncogenic event of human tumorigenesis.
24631383 The polymorphism in DNMT1 might be associated with oligospermia and could modify the susceptibility of oligospermia.
24532244 These findings strongly support the autoinhibitory role of the RFTS domain, and indicate that it contributes to the regulation of Dnmt1 activity in cells.
24515776 Upregulation of DNMT1 is associated with gastric cancer.
24502362 Hypermethylated E2F transcription factor 1 (E2F1) motif is a key regulatory element for the DNMT1 gene in BRCA1-mutated breast cancer
24492612 Malignant brain tumor domain of PHF20L1 reads and controls enzyme levels of methylated DNMT1 in cells, thus representing a novel antagonist of DNMT1 degradation.
24475290 Inhibition of HDAC1 and DNMT1 modulate RGS10 expression and decrease ovarian cancer chemoresistance.
24464625 Overexpression of DNMT1/3a was correlated with promoter hypermethylation and reduced expression of estrogen receptor-alpha and BRCA1.
24459426 Association of self-DNA mediated TLR9-related gene, DNA methyltransferase, and cytokeratin protein expression alterations in HT29-cells to DNA fragment length and methylation status.
24449497 DNMT1 depletion plays an essential role in the enhancement of liver cancer stem cell malignancies.
24441913 DNMT inhibitors facilitate the Pi-induced development of vascular calcification via the upregulation of the ALP expression along with a reduction in the DNA methylation level of the ALP promoter region.
24434851 Interaction between DNMT1 and MBD4 is involved in controlling gene expression and responding to oxidative stress.
24389641 Studies indicate that dysregulation of DNA methyltransferase 1 (DNMT1) is implicated in a variety of diseases and cancer.
24247422 DNMT1 could suppress RASSF1A expression independently of its regional DNA methylation status.
24107992 identification of a novel RNA arising from the CEBPA gene locus that is critical in regulating the local DNA methylation profile; this RNA binds to DNMT1 and prevents CEBPA gene locus methylation
24098518 common variants in the DNMT1 and DNMT3B genes influence inter-individual variation in global DNA methylation and the three loci investigated here.
24094292 Both DNMT1 and AIM1 show maternal allele-specific methylation and paternal allele-specific transcription.
24038143 The E2F1/DNMT1 axis is associated with the development of AR negative castration resistant prostate cancer.
24001151 Mahanine treatment induces the proteasomal degradation of DNMT1 and DNMT3B via the inactivation of Akt, which facilitates the demethylation of the RASSF1A promoter and restores its expression in prostate cancer cells.
23990460 Data indicate that only the DNMT1 CXXC domain substitutes in an MLL leukemia model because of similar capacity to protect from CpG DNA methylation and H3K9 methylation.
23957506 DNMT1 polymorphisms are associated with cancer.
23938174 This study demonistrated that the expressions of DNMT1 and TET1 are increased in patient with schizophrenia.
23918933 The results suggest that DNMT1 function in the regulatory response is controlled by NBS1.
23918800 Data indicate oncogenic HRAS (HRAS(G12V)) as a potent mediator of SLC5A8 silencing in human nontransformed normal mammary epithelial cell lines and in mouse mammary tumors through DNMT1.
23867713 Results show that silencing DNMT1 expression normalized eNOS expression in intrauterine growth restricted fetuses endothelial cells, and restored the normal response to hypoxia in HUVEC.
23846337 Restoration of GKN1 protein suppressed gastric cancer cell growth by inducing endogenous miR-185 that directly targets epigenetic effectors DNMT1 and EZH2 in gastric cancer cells.
23820632 The decreased expression of DNMT1 and DNMT3B mRNA may play an important role in the pathogenesis of TOF.
23775084 Data suggest that enhanced PP2Ac in systemic lupus erythematosus (SLE) T-cells may dephosphorylate and activate the signaling pathway upstream of DNMT1, thus disturbing the tight control of methylation-sensitive genes involved in SLE pathogenesis.
23771421 Three functional polymorphisms (rs12984523, rs16999593, and rs2228612)in DNMT1 were not associated with noise-induced hearing loss in a Chinese factory worker population.
23706494 UVB enhanced DNA hypomethylation of CD4+ T cells in systemic lupus erythematosus via inhibiting DNMT1 catalytic activity in a dosage-dependent manner.
23671287 SW155246 showed a 30-fold preference for inhibition of human DNMT1 versus human or murine DNMT3A or -3B, inhibited global methylation in HeLa cells, and reactivated expression of the tumor suppressor gene RASSF1A in A549 cells.
23666104 DNMT1 variants may be risk factors of ovarian cancer.
23652987 Ginseng saponin is a potential candidate as DNMT1 inhibitor in the chemoprevention of cancer.
23624957 HLCS interacts physically with the DNA methyltransferase DNMT1 and the methyl CpG binding protein MeCP2 to facilitate the binding of HLCS to chromatin.
23549984 Results show that miR-148a may regulate RUNX3 expression through modulation of DNMT1-dependent DNA methylation in gastric cancer and highlight a miRNA-epigenetics regulation mechanism of gene expression.
23545144 These results demonstrated that down-regulation of DNMT1 or DNMT3B expression in Huh7.5.1 cells severely impaired cell culture-produced hepatitis C virus infection.
23478041 Data indicate that salivary gland epithelial cells (SGEC) demethylation in Sjogren's syndrome (SS)patients was associated with a 7-fold decrease in DNA methyl transferase DNMT1 and a 2-fold increase in Gadd45-alpha expression.
23463006 UHRF1 can target DNMT1 for DNA maintenance methylation through binding either histone 3 lysine 9 methylation 2/3 or hemi-methylated CpG.
23393137 mammalian DNMT1, DNMT3B, and, to a much less extent, DNMT3A, can also act in vitro as DNA demethylases in a Ca2+ ion- and redox state-dependent manner
23365052 DNMT1 mutations in patients presenting with familial frontotemporal dementia or primary memory decline may also have sensory neuropathy and hearing loss, or phenotype for narcolepsy.
23364257 Both expression level and activity of DNMT1 were inversely correlated with the expression level of BNIP3 in colon carcinoma cells after treatment with chemotherapeutic agents and radiation
23318422 were involved in ovarian cancer cisplatin resistance in vitro and in vivo by targeting DNMT1 directly.
23254386 Higher levels of expression of DNMT1 in prostate cancer cells is associated with a more aggressive phenotype.
23249948 HBP1 represses the DNMT1 gene through binding a high-affinity site in the DNMT1 promoter.
23242655 mutant p53 protein binds to the promoter of ESR1 through direct interaction with HDAC1 and indirect interaction with DNMT1, MeCP2 proteins in the ER-negative MDA-MB-468 cells.
23127209 Abnormal expression levels of DNMT1 and methyl-CpG binding domain protein 2 demethylase mRNA may be important causes of the global hypomethylation observed in CD4+T cells in systemic lupus erythematosus.
23125218 Upregulation of DNMT1 is associated with neoplastic transformation.
23079992 Two SNPs, rs16999593 in DNMT1 and rs2424908 in DNMT3B, are significantly associated with breast cancer risk.
23072722 Data suggest that LSD1 (lysine-specific demethylase 1) is critical in the regulation of cell proliferation, but not an absolute requirement for the stabilization of either p53 or DNMT1(DNA methyltransferase 1).
23064049 results indicate DNMT1 is essential for maintenance of colon cancer stem-like cells/cancer-initiating cells and short-term suppression of DNMT1 might be sufficient to disrupt cancer stem-like cells/cancer-initiating cells
23049933 Results suggested that SNPs of DNMT1 could be used as genotypic markers for predicting genetic susceptibilities to H.pylori infection and risks in gastric atrophy.
23041765 Ciprofloxacin has antifibrotic actions in Systemic sclerosis dermal and lung fibroblasts via the downregulation of Dnmt1, the upregulation of Fli1.
23039890 The DNMT1+32204GG genotype correlates with DNA hypomethylation.
22975348 these data demonstrated for the first time that ERalpha could upregulate DNMT1 expression by directly binding to the DNMT1 promoter region in MFC-7(ER )/PTX cells.
22942708 DNMT1, DNMT2 and DNMT3A may play important roles in gastric cancer carcinogenesis.
22898998 increased Dnmt1 expression in DDX20-deficient cells hypermethylated the promoters of metallothionein genes, resulting in decreased metallothionein expression leading to enhanced NF-kappaB activity
22894906 A review of the various regulatory mechanisms and interactions of DNMT1.
22879518 MT-ND6 transcriptional regulation dependent on the enhanced expression of the mitochondrial-targeted isoform of the DNA (cytosine-5) methyl transferase 1 (DNMT1).
22795133 Oct4 and Nanog directly regulate Dnmt1 to maintain self-renewal and undifferentiated state in mesenchymal stem cells
22768205 The data from this study provided the first evidence for differential expression of DNMTs proteins in ovarian cancer tissues and their associations with clinicopathological and survival data in sporadic ovarian cancer patients.
22739025 induction of DNMT1 expression in the chronically inflamed colon may release IL-6 signaling towards signal transducer and activator of transcription 3 from inhibition through SOCS3 increasing the propensity to malignant transformation.
22547080 Pregnancy and the DNMT1a genotype independently influence the arsenic methylation phenotype
22520950 data suggest that overexpression of DNMT1, DNMT3a, and DNMT3b might represent a critical event responsible for the epigenetic inactivation of multiple tumor suppressor genes, leading to the development of aggressive forms of sporadic breast cancer
22455563 MeCP2, DNMT1 and H4Ac expression levels did not correlate with any of tested clinicopathological parameters in breast invasive ductal carcinoma tissues
22403725 Wnt7a is lost by methylation in a subset of tumors and that this methylation is maintained by DNMT1
22362755 In human hepatocellular carcinoma, increased DNMT1 expression is negatively correlated with SHP levels.
22349384 Decreased expression levels of DNMT1, DNMT3a, and DNMT3b in the ectopic endometrium and eutopic endometrium may play a role in patients with abnormal epigenetics which may lead to endometriosis.
22328086 Mutations in DNMT1 cause autosomal dominant cerebellar ataxia, deafness and narcolepsy.
22317856 supported the idea that NNK-induced DNMT1 expression may result from protein stabilization. Increased DNMT1 protein expression may play a critical role in the malignant progression of larynx.
22301400 Increased DNMT1 gene expression is associated with carcinogenesis in pancreatic ductal adenocarcinoma.
22295098 reduced microRNA-152 can lose an inhibitory effect on DNA methyltransferase, which leads to hypermethylation of the ERalpha gene and a decrease of ERalpha level
22264301 DNMT1 hypermethylation is a late part of glioma progression.
22236544 Increased expression of DNMT1 was observed in oral lichen planus compared to the control group
22219193 Regulation of human RNA polymerase III transcription by DNMT1 and DNMT3a DNA methyltransferases.
22167392 DNMT1 was over-expressed in primary tumors and cell lines, while knockdown of DNMT1 using siRNA could decrease methylation level of miR-148a promoter and restore its expression
22110720 DNMT1 and DNMT3a are regulated by GLI1 in pancreatic cancer, and DNMT1 is its direct target gene
22072770 Elevated expression of DNMT1 or DNMT3B alone is not required to maintain restricted latency.
22048249 analysis of DNMT1, expression showed peaks of mRNA transcripts in primary spermatocytes and in mature ejaculated spermatozoa, with DNMT1 transcript level being the most abundant in all cell stages. I
21999220 DNMT1 silencing is associated with malignant phenotype and methylated tumor suppressor gene expression in cervical cancer
21966451 Results suggest that DNMT1 operates either as a functional intermediary or in cooperation with E2F1 inhibiting AR gene expression in a methylation independent manner.
21962230 MiR-185 targets the DNA methyltransferases 1 and regulates global DNA methylation in human glioma
21947282 SIRT1 deacetylates the DNA methyltransferase 1 (DNMT1) protein and alters its activities
21887463 Significantly higher levels of CXCR4, DNMT3A, DNMT3B and DNMT1 transcript (p=0.0058, 0.0163, 0.0003 and <0.0001, respectively) levels in cancer tissue as compared to normal samples.
21826395 Dnmt1 was principally expressed in the nucleus & cytoplasm of NeuN-positive neurons, but not in GFAP-positive astrocytes. Levels were significantly increased in patients with temporal lobe epilepsy.
21791605 Data show that trichostatin A treatment reduces global DNA methylation and the DNMT1 protein level and alters DNMT1 nuclear dynamics and interactions with chromatin.
21757290 Data show that Core inhibited p16 expression by inducing promoter hypermethylation via up-regulation of DNMT1 and DNMT3b.
21756783 PARP1 could regulate DNA methylation by inhibiting the enzyme activity of DNMT1 in bronchial epithelial cells exprosed to B(a)P.
21735817 DNMT1 as a key enzyme in maintaing of proper methylation pattern is a attractive target in anti-tumor therapy.
21636528 These results offer an explanation for how and why unmethylated microsatellite repeats can be destabilized in cells with decreased DNMT1 levels and uncover a novel and important role for PARP in this process.
21619587 Results indicate that phosphorylation of human DNMT1 by protein kinase C is isoform-specific and provides the first evidence of cooperation between PKCzeta and DNMT1 in the control of the DNA methylation patterns of the genome.
21592522 Data show that the levels of DNMT1 mRNA were significantly decreased in a depressive but not in a remissive state of MDD and BPD.
21573703 DNA methylation of the BNIP3 promoter was mediated by DNMT1 via the MEK pathway
21565830 findings describe a new mechanism for the regulation of DNMT1 and aberrant DNA hypermethylation in colorectal cancer
21565170 these results suggest that dysregulation of cell cycle via CDKs could induce abnormal phosphorylation of DNMT1 and lead to DNA hypermethylation often observed in cancer cells.
21539677 The proportion of cells that express DNMT1 at the mRNA and protein levels in esophageal squamous cell carcinoma clinical samples is generally higher than in paired non-cancerous tissues.
21532572 Here we show that mutations in DNMT1 cause both central and peripheral neurodegeneration in one form of hereditary sensory and autonomic neuropathy with dementia and hearing loss.
21523767 DNMT1 could be a significant clinical predictor for stage and treatment response of bladder cancer.
21478913 These findings show an important role for p53 in the progression of serous borderline ovarian tumors to an invasive carcinoma, and suggest that downregulation of E-cadherin by DNMT1-mediated promoter methylation contributes to this process.
21459093 Study provides evidence for nuclear receptor mediated regulation of Dnmt1 expression through ERRgamma and SHP crosstalk.
21458988 Low DNMT1 expression defines a subgroup of GC patients with better outcomes following platinum/5FU-based neoadjuvant chemotherapy. In vitro data support a functional relationship between DNMT1 and cisplatin sensitivity.
21395176 Increased expression of DNMT1 may initiate the oncogenesis of laryngeal squamous cell carcinoma. Smoking may induce expression.
21389349 the naked DNA- and polynucleosome-binding activities of Dnmt1 are inhibited by the RFTS domain, which functions by virtue of binding the catalytic domain to the exclusion of DNA
21353307 Results implied that IL-6 expression was regulated by promoter demethylation induced by down-regulation of DNMT activity.
21347439 DNA methylation recovery was mediated by the major human DNA methyltransferase, DNMT1
21321201 Mitochondrial DNMT1 appears to be responsible for mtDNA cytosine methylation.
21316665 Expression level of DNMT1 is significantly higher in secretory-phase endometrium compared with proliferative endometrium and menstrual endometrium.
21311766 Different binding properties and function of CXXC zinc finger domains in Dnmt1 and Tet1.
21296890 association of Dnmt1 and alpha-synuclein might mediate aberrant subcellular localization of Dnmt1
21268065 Findings suggest that, by balancing Dnmt1 ubiquitination, Usp7 and Uhrf1 fine tune Dnmt1 stability.
21266713 Control of DNMT1 abundance in epigenetic inheritance by acetylation, ubiquitylation, and the histone code.
21229291 we report significant overexpression of DNMT1 and DNMT3B in glioma
21163962 structure of DNMT1 composed of CXXC, tandem bromo-adjacent homology (BAH1/2), and methyltransferase domains bound to DNA-containing unmethylated CpG sites; studies identify an autoinhibitory mechanism of DNA methylation
21151116 Modifications to DNMT1 mediated by AKT1 and SET7, affect cellular DNMT1 levels.
21078759 This study demonstrated that patients with SLE had a significantly lower level of DNA methylation than the controls, and that expression of both DNMT1 and MBD2 mRNA was significantly increased in the SLE patients compared with controls.
21045206 a previously unknown mode of regulation of DNMT1 protein stability through the coordinated action of an array of DNMT1-associated proteins.
21042757 HPV-16 E6 may act through p53/ DNMT1 to regulate the development of cervical cancer.
20980350 Depletion of DNMT1 did not induce cellular invasion in MCF-7 and ZR-75-1 non-invasive breast cancer cell lines.
20970125 The mRNA of DNMT1 (DNA-methyltransferase 1) is expressed in the endometrium across the menstrual cycle.
20951977 lower levels of DNMT1 may be related with smoking habit. significantly higher mean percentage of DNMT1 immunoreactivity in non-smokers
20940144 our studies provide compelling additional evidence for DNMT1 acting as a regulator of genome integrity and as an early responder to DNA DSBs.
20937307 The anti-TNFalpha biological agents do not seem to affect DNA methylation and mRNA expressions of DNMT1 and MBD2 in RA
20920981 The current work shows that polymorphisms of the DNMT1 gene in exons may affect the individual intraductal carcinoma risk in women of the northeast of China.
20920981 Observational study of gene-disease association. (HuGE Navigator)
20875141 In MCF7 cells, ANT2 knockdown enhanced the expression and activity of DNA methyltransferase 1 (DNMT1).
20840813 The expression of DNMT1 was significantly higher in lung cancer tissues than in corresponding normal lung tissues.
20620135 Regulation of DNMT1 and DNMT3A by HBx promoted hypermethylation of p16(INK4A) promoter region
20613874 results reveal that the disruption of Dnmt1/PCNA/UHRF1 interactions acts as an oncogenic event and that one of its signatures (i.e. the low level of mMTase activity) is a molecular biomarker associated with a poor prognosis in GBM patients
20593030 Observational study of gene-disease association. (HuGE Navigator)
20592467 interaction between hNaa10p and DNMT1 was required for E-cadherin silencing through promoter CpG methylation, and E-cadherin repression contributed to the oncogenic effects of hNaa10p.
20588031 Increased expression of DNMT1 in non-neoplastic epithelium may precede or be a relatively early event in ulcerative colitis-associated tumorigenesis.
20570896 Data provided compelling evidence that deregulation of DNMT1 is associated with gain of transcriptional activation of Sp1 and/or loss of repression of p53.
20428781 thymine DNA glycosylase was not up-regulated in DNMT1 nor 3B knockdown cancer cells
20398055 DNMT1 and DNMT3b silencing sensitizes human hepatoma cells to TRAIL-mediated apoptosis via up-regulation of TRAIL-R2/DR5 and caspase-8.
20381114 expression of DNA methyltransferase 1, 3a, and 3b showed significantly higher levels in stage IV tumors than in stage I or II tumors
20354000 Our results indicate that DNMT-mediated gene silencing may play a role in inflammation-associated colon tumorigenesis.
20335008 Our results suggest that one potential mechanism by which varenicline may decrease cigarette smoking in schizophrenia is by decreasing DNMT1 mRNA.
20228804 Dnmt1 and Dnmt3a transgenes are required for synaptic plasticity, learning and memory through their overlapping roles in maintaining DNA methylation and modulating neuronal gene expression in adult central nervous system neurons.
20192608 No association between DNMT1 polymorphisms and gastric cancer.
20192608 Observational study of gene-disease association. (HuGE Navigator)
20192566 No association between DNMT1 and colorectal cancer in Iranian patients.
20147412 Hepatitis B virus-induced overexpression of DNMTs leads to viral DNA methylation and decreased viral gene expression and also leads to methylation of host CpG islands.
20093774 Carcinogne-induced DNMT1 accumulation and subsequent hypermethylation of the promoter of tumor suppressor genes may lead to tumorigenesis and poor prognosis.
20081831 DNMT1 is essential for epidermal progenitor cell function
20071580 Data suggest that KSHV miRNA targets multiple pathways to maintain KHSV latency, including repression of the viral protein Rta and a cellular factor, Rbl2, and increased cellular DNMT, in regulating global epigenetic reprogramming.
20071334 DNA methylation-mediated down-regulation of DNA methyltransferase-1 (DNMT1) is coincident with, but not essential for, global hypomethylation in human placenta
20044957 The DNMT 1 is the key enzyme responsible for DNA methylation, which often occurs in CpG islands located near the regulatory regions of genes and affects transcription of specific genes. Two intron polymorphisms of DNMT1 might affect HBV clearance.
19957555 Downregulation of DNMT1 can inhibit cervical cancer cell proliferation and induce cell apoptosis.
19936946 Observational study of gene-disease association. (HuGE Navigator)
19932585 Our results indicate that DNMT1 plays the main role in maintenance of methylation of CXCR4 promoter, while DNMT3B may function as an accessory DNA methyltransferase to modulate CXCR4 expression in AsPC1 cells.
19896490 Observational study of gene-disease association. (HuGE Navigator)
19798569 Our data suggest there is no apparent association of common DNMT-1 and DNMT-3B polymorphisms with the risk of breast cancer in Chinese women.
19763880 The expression of DNMT1, DNMT2, DNMT3A and DNMT3B in pediatric acute lymphoblastic leukemia patients, was investigated.
19539327 genetic and phenotypic consequences of silencing DNMT1 in PC3 cells are markedly different from those in colon and gastric cancers, indicating that DNMT1 preferentially targets certain gene promoters
19531770 Increase of DNMT1 expression is associated with multiple myeloma and plasma cell leukemias.
19468253 Our results were not able to demonstrate a clear correlation between DNMT1 and DNMT3a immunoexpression and salivary gland neoplasms development.
19465937 the role of promoter region DNA hypermethylation as a mediator of gene silencing in glioblastoma multiforme cell line using RNAi directed against DNMT1 and DNMT3b was investigated.
19450230 SUMOylation significantly enhances the methylase activity of DNMT1 both in vitro and in chromatin.
19424621 Higher expression of DNMT1 and HDAC1 correlated with advanced stages of the disease and reflect the malignancy of pancreatic carcinoma.
19399937 DNA methyltransferase 1 (DNMT1) expression was increased in hepatocellular carcinoma compared to non-neoplastic liver tissues and the incidence of DNMT1 immunoreactivity in HCCs correlated significantly with poor tumor differentiation.
19399408 Silencing DNMT3b and DNMT1 could inhibit the cell growth and promote apoptosis of bladder carcinoma cells.
19394279 Data showed that the CD70, perforin and KIR2DL4 promoters are demethylated in CD4(+)CD28(-) T cells, and that DNA methyltransferase 1 (Dnmt1) and Dnmt3a levels are decreased in this subset.
19386473 In patient with schizophrenia the DNA-methyltransferase 1 was up regulation in telencephalic GABAergic neurons.
19339266 EBV latent membrane protein 2A (LMP2A) up-regulated DNMT1, leading to an increase in methylation of the PTEN promoter in stomach cancer.
19292979 DNMT1 levels in tumor cells may determine the effectiveness of doxorubicin in chemotherapy.
19282482 signaling through SET7 represents a means of DNMT1 enzyme turnover
19279403 Panobinostat treatment depletes DNMT1 levels and enhances decitabine mediated repression of JunB and loss of survival of human acute leukemia cells.
19275888 p21(WAF1)-p300-DNMT1 pathway may play a pivotal role to ensure regulated DNMT1 expression and DNA methylation in mammalian cell division.
19246518 Observational study of gene-disease association. (HuGE Navigator)
19236003 Incorporation of 6-thioguanine into the CpG site affects the methylation of the cytosine residue by both DNMT1 and HpaII. The effect on cytosine methylation is dependent on the position of 6-thioguanine with respect to the cytosine to be methylated.
19211935 miR-29b down-regulates DNMT1 indirectly by targeting Sp1.
19173286 mapped the dimerization domain to the targeting sequence TS that is located in the center of the N-terminal domain (amino acids 310-629)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19019634 The ratio of MBD-2/DNMT-1 might be valuable in explanation of hypomethylation and evaluation of clinical activity of systemic luopus erythematosus.
19016755 Interaction between DNMT1 and DNA replication reactions in the SV40 in vitro replication system is reported.
18931722 DNMT1 and HLA-DRalpha are prognostic factors for hepatocelluar carcinoma.
18829110 elevated DNMT1 expression may in particular contribute to ineffective erythropoiesis in MDS.
18754681 The CXXC domain in the amino terminus region of DNMT1 cooperates with the catalytic domain for DNA methyltransferase activity.
18680430 study shows endogenous DNMT1 & CFP1 interact in vivo; CFP1 interaction with Setd1A or Setd1B not required for its interaction with DNMT1; result indicates CFP1 intersects cytosine methylation machinery independently of its association with Setd1 complexes
18567946 The HIV-1 responsive element resides in the 5' most 420 bp of the -1634 to +71 DNMT1 promoter; positioning of this truncated promoter proximal to a hybrid SV40-DNMT1 reporter results in HIV-1-dependent regulation
18563322 DNMT1 and DNMT3b will increase their biological effects and have a synergistic effect on suppressing the growth of cholangiocarcinoma
18505931 histone deacetylase inhibition promotes ubiquitin-dependent proteasomal degradation of DNA methyltransferase 1 in human breast cancer cells
18499700 The association between sequence variants of DNMT1 and 3B and mutagen sensitivity induced by BPDE supports the involvement of these DNMTs in protecting the cell from DNA damage.
18499700 Observational study of gene-disease association. (HuGE Navigator)
18414412 DNMT1 may play an important role in modulating NSCLC patient survival and thus be useful for identifying NSCLC patients who would benefit most from aggressive therapy.
18413740 Chromatin immunoprecipitation analysis of the BAG-1 promoter in DNMT1-overexpressing or DNMT3B-overexpressing colon cells show a permissive chromatin status assoscsiated with DNA binding of BORIS.
18404674 DNMT1 protein overexpression might contribute to aberrant DNA hypermethylation of specific tumor suppressor genes in endometrial cancers.
18253830 DNMT1 was over expressed in gastric neoplasms.
18252747 Study shows that the maintenance DNA methyltransferase Dnmt1, which preserves the patterns of CpG methylation, plays a key role in CAG repeat instability in human cells and in the male and female mouse germlines.
18204201 The subcellular localization of DNMT1 can be altered by the addition of IL-6, and this process is greatly enhanced by phosphorylation of the DNMT1 nuclear localization signal (NLS) by PKB/AKT.
18202356 Parental Dnmt1 is a modifier of transmission of alleles at an unlinked chromosomal region and perhaps has a role in the genesis of transmission ratio distortion.
18198215 DNMT-1 has a direct suppressive role in 15-LOX-1 transcriptional silencing that is independent of 15-LOX-1 promoter DNA methylation
18049164 In hepatocellular carcinoma, DNMT1 is necessary to maintain the methylation of CpG islands in certain tumor-related genes.
18038118 mutant p53 loses its ability to suppress DNMT1 expression, and thus enhances methylation levels of the p16 ( ink4A ) promoter and subsequently down-regulates p16(ink4A )protein.
17991895 reveals novel functions for DNMT1 as a component of the cellular response to DNA damage, which may help optimize patient responses to this agent in the future
17965595 DNMT1 expression is increased in schizophrenia (SZ) and bipolar (BP) disorder brains. [REVIEW]
17934516 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression.
17931718 establish a link between HESX1 and DNMT1 and suggest a novel mechanism for the repressing properties of HESX1
17893234 DNA methyltransferase (DNMT) 1 over-expression is not a secondary result of increased cell proliferative activity but is significantly correlated with the CpG island methylator phenotype.
17716861 These results suggested that PKB enhanced DNMT1 stability and maintained DNA methylation and chromatin structure, which might contribute to cancer cell growth.
17698033 mahanine can reverse an epigenetically silenced gene, RASSF1A in prostate cancer cells by inhibiting DNMT activity that in turn down-regulates a key cell cycle regulator, cyclin D1
17673620 data suggest that UHRF1 may help recruit DNMT1 to hemimethylated DNA to facilitate faithful maintenance of DNA methylation
17657744 SUV39H1 is significantly associated with DNMT1, but not with euchromatic promoter methylation in colorectal cancer
17538945 Progressive up-regulation of the gene encoding DNMT1 was found in the colorectal adenoma-carcinoma sequence.
17532557 DNMT1 plays a key role in maintenance of methylation, and DNMT3B may act as an accessory DNA methyltransferase to epigenetically silence CXCL12 expression in MCF-7 and AsPC1 cells
17492476 LAT, ZAP-70, and DNMT1 protein levels in CD4(+) T cells can be associated with systemic lupus erythematosus.
17470536 Direct interactions between HP1 and DNMT1 mediate silencing of euchromatic genes.
17322882 DNMT1 is required for faithfully maintaining DNA methylation patterns in human cancer cells and is essential for their proliferation and survival.
17312023 DNMT1 is essential for the maintenance of DNA methylation patterns in human cells.
17178861 LMP1 induces formation of a transcriptional repression complex, composed of DNMT1 and histone deacetylase, which locates on E-cadherin gene promoter.
17093909 These findings suggested that DNMT1 was associated with the malignant phenotype, and dysregulation of DNMT1 expression was present in tumor cells of colorectal cancer.
17085482 Direct cooperation between DNMT1 and G9a provides a mechanism of coordinated DNA and H3K9 methylation during cell division.
17081533 The genes DNMT1, DNMT3A, and DNMT3B were over-expressed in the ectopic endometrium as compared with normal control subjects or the eutopic endometrium of women with endometriosis.
17067458 DNMT1 expression was correlated to the methylation of RASSF1A, tumor grade and stage, which implied that DNMT1 may contribute to the carcinogenesis and development of adenoid cystic carcinoma.
17053888 The increased DNMT1 expression was more frequent in adenocarcinoma vs. squamous cell carcinoma (42% vs 19%). Smokers with ~65 packyears showed 4.17 times higher risk of increased DNMT1 expression compared to those who smoked 45 packyears in adenocarcinoma
17030625 AUF1 cell cycle variations define genomic DNA methylation by regulation of DNMT1 mRNA stability
17015478 depletion of DNMT1 with either antisense or small interfering RNA (siRNA) specific to DNMT1 activates a cascade of genotoxic stress checkpoint proteins
16998846 Sex-specific time windows for concomitant upregulation of DNMT1 are associated with prenatal remethylation of the human male and female germ line.
16963560 Data suggest that DNMT1 might be essential for maintenance of DNA methylation, proliferation, and survival of cancer cells.
16960727 study demonstrated that expression of DNMT1 is clearly regulated in both impaired spermatogenesis and development of embryonal carcinoma, while HDAC1 expression is not regulated during aberrant germ cell differentiation
16897079 suppression of DNMT-1 might be related to the pathogenesis of atopic dermatitis, especially in whom serum IgE level is high
16861352 STAT3 binds in vitro to 2 STAT3 SIE/GAS-binding sites identified in promoter 1 and enhancer 1 of the DNMT1 gene
16801630 Inhibitors of DNMT1 may have clinical relevance for immune modulation by augmentation of cytokine effects and/or expression of tumor-associated antigens.
16769694 In human cells maintenance of XIST methylation is controlled differently than global genomic methylation and in the absence of both DNMT1 and DNMT3B.
16537562 DNMT1 protein overexpression may be responsible for aberrant DNA methylation during multistage carcinogenesis of the pancreas
16497664 down-regulation of DNMT1 methyltransferase leads to activation and stable hypomethylation of MAGE-A1 in melanoma cells
16424002 human cancer cells may differ in their reliance on DNMT1 for maintaining DNA methylation
16423997 data suggests a potential role for DNMT1 in the initiation of promoter CpG island hypermethylation in human cancer cells
16322686 Breast cancer cells have a prominent loss of DNA methylation accompanied by altered expression of maintenance DNA methyltransferase DNMT1.
16314526 DNMT1 is necessary for proper PcG body assembly independent of DNMT-associated histone deacetylase activity.
16227093 necessary for both class switching and somatic hypermutation in B cells
16053511 These data suggest that increased DNMT1 protein expression participates in multistage pancreatic carcinogenesis from the precancerous stage to malignant progression of ductal carcinomas and may be a biological predictor of poor prognosis.
15956212 Direct role of Dnmt1 in the restoration of epigenetic information during DNA repair.
15870198 STAT3 may transform cells by inducing epigenetic silencing of SHP-1 in cooperation with DNMT1 and histone deacetylase 1
15799776 Unlike Dnmt1, pre-existing cytosine methylation at CpG sites or non-CpG sites does not stimulate Dnmt3a activity in vitro and in vivo.
15762053 Increased DNMT1 gene expression appears to be in lymphomas and maybe associated with oncogenesis in this group of tumors.
15755728 DNMT1 protein levels are elevated in breast cancer tissues and in MCF-7 breast cancer cells relative to normal human mammary epithelial cells without a concomitant increase in DNMT1 mRNA or proliferative fraction.
15735013 Results suggest a novel mechanism for gene silencing mediated by RUNX1/MTG8 and support the combination of HDAC and DNMT inhibitors as a novel therapeutic approach for t(8;21) AML.
15657147 DNMT1- and p53-mediated methylation of the survivin promoter, suggesting cooperation between p53 and DNMT1 in gene silencing.
15526354 The average mRNA level of Dnmt1 gene from cancerous tissue was higher and that of mbd2 gene from cancerous tissue was lower than that from non-cancerous tissue
15375672 Observational study of gene-disease association. (HuGE Navigator)
15340041 Expression levels of DNMT1 in tumor cells may affect the effectiveness of doxorubicin in chemotherapy.
15289832 inhibition of DNA methylation by DNMT1 by an antisense oligodeoxynucleotide influences cell morphology and adhesion
15220328 DNMT1 activity contributes to the preservation of the correct organization of large heterochromatic regions
15087453 DNA methyltransferase 1 knock down induces gene expression by a mechanism independent of DNA methylation and histone deacetylation
14684836 hypothesis that the increase of DNA-methyltransferase 1 expression in telencephalic GABAergic interneurons of schizophrenia patients causes a promoter hypermethylation of reelin and GAD(67) and perhaps of other genes expressed in these interneurons
14583449 Activation of p53 reduces binding and relieves transcriptional repression of the Dnmt1gene, whereas loss of p53, a frequent, early event in tumorigenesis, may significantly contribute to aberrant genomic methylation.
14577574 gene expression as a likely mechansism in underlying causes of changes in DNA methylation in aging and tumorigenesis
14559786 DNMT1 plays a key role in methylation maintenance, DNMT3b may act as an accessory to support the function in ovarian cancer cells.
12804601 structural homology model for human DNA methyltransferase 1
12789259 We investigated occupancy of ER-alpha promoter by pRb2/p130-E2F4/5-HDAC1-SUV39 H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 complexes, and provided a link between pRb2/p130 and chromatin-modifying enzymes in the regulation of ER-alpha transcription
12738984 Over-expressed in squamous cell carcinoma of the mouth.
12637155 mutational inactivation of the DNMT1 gene that potentially causes a genome-wide alteration of DNA methylation status may be a rare event during human carcinogenesis
12594811 Decrease of DNA methyltransferase 1 expression relative to cell proliferation in transitional cell carcinoma.
12576480 reduction in DNMT1 triggers intra-S-phase arrest of DNA replication proposed to protect the genome from extensive DNA demethylation.
12548018 DNA methylation is tightly coupled to replication through physical interaction of DNMT1 and core components of the replication machinery.
12538344 Human DNA methyltransferase gene DNMT1 is regulated by the APC pathway
12530095 DNMT1 gene copy number does not influence susceptibility to development of malignant lymphoproliferative disease.
12496760 DNMT1 is required to maintain CpG methylation and aberrant gene silencing in human cancer cells.
12145218 the human de novo enzymes hDNMT3a and hDNMT3b form complexes with the major maintenance enzyme hDNMT1.
11932749 DNMT1 and DNMT3b cooperate to silence genes in human cancer cells
11834837 recruited to the RARbeta2 promoter by the PML-RAR fusion protein

AA Sequence

MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRK      1 - 70
EELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRR     71 - 140
SKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSR    141 - 210
ERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDE    211 - 280
KDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHP    281 - 350
PKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC    351 - 420
PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMD    421 - 490
PSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQ    491 - 560
VESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDT    561 - 630
FFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEAD    631 - 700
DDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDS    701 - 770
SKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS    771 - 840
ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRV    841 - 910
LEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYI    911 - 980
KGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAV    981 - 1050
VDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKP   1051 - 1120
KSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTED   1121 - 1190
CNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP   1191 - 1260
RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEP   1261 - 1330
LHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQL   1331 - 1400
RGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSG   1401 - 1470
ALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVL   1471 - 1540
HPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKE   1541 - 1610
EEAAKD                                                                   1611 - 1616
//

Text Mined References (415)

PMID Year Title
27087738 2016 Polymorphisms of the DNA Methyltransferase 1 Gene Predict Survival of Gastric Cancer Patients Receiving Tumorectomy.
27071379 2016 Differential expression of the epigenetic methylation-related protein DNMT1 by breast cancer molecular subtype and stromal histology.
27021683 2016 MiR-140-5p regulates hypoxia-mediated human pulmonary artery smooth muscle cell proliferation, apoptosis and differentiation by targeting Dnmt1 and promoting SOD2 expression.
26929335 2016 Human DNMT1 transition state structure.
26892683 2016 Expression of DNA methyltransferases 1 and 3B correlates with EZH2 and this 3-marker epigenetic signature predicts outcome in glioblastomas.
26815200 2016 DNMT1 and HDAC2 Cooperate to Facilitate Aberrant Promoter Methylation in Inorganic Phosphate-Induced Endothelial-Mesenchymal Transition.
26782424 2015 Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine.
26774342 2016 High inorganic phosphate causes DNMT1 phosphorylation and subsequent fibrotic fibroblast activation.
26676363 2016 Epigenetic repression of long non-coding RNA MEG3 mediated by DNMT1 represses the p53 pathway in gliomas.
26602018 2015 Chaperoning epigenetics: FKBP51 decreases the activity of DNMT1 and mediates epigenetic effects of the antidepressant paroxetine.
26530812 2016 IL-8 suppresses E-cadherin expression in nasopharyngeal carcinoma cells by enhancing E-cadherin promoter DNA methylation.
26497367 2015 miR-124 and miR-506 inhibit colorectal cancer progression by targeting DNMT3B and DNMT1.
26454216 2016 Interplay between menin and Dnmt1 reversibly regulates pancreatic cancer cell growth downstream of the Hedgehog signaling pathway.
26416384 2015 Association of DNA methyltransferases expression with global and gene-specific DNA methylation in colorectal cancer cells.
26362062 2015 Activation of SAPK/JNK mediated the inhibition and reciprocal interaction of DNA methyltransferase 1 and EZH2 by ursolic acid in human lung cancer cells.
26337869 2015 DNMT1 mediates chemosensitivity by reducing methylation of miRNA-20a promoter in glioma cells.
26333125 2015 Curcumin-Mediated Reversal of p15 Gene Promoter Methylation: Implication in Anti-Neoplastic Action against Acute Lymphoid Leukaemia Cell Line.
26307088 2015 DNMT1-associated long non-coding RNAs regulate global gene expression and DNA methylation in colon cancer.
26305882 2015 Methyltransferase expression and tumor suppressor gene methylation in sporadic and familial colorectal cancer.
26299326 2015 Anticancer drugs induce hypomethylation of the acetylcholinesterase promoter via a phosphorylated-p38-DNMT1-AChE pathway in apoptotic hepatocellular carcinoma cells.
26261487 2015 Overexpression of DNA methyltransferase 1 (DNMT1) protein in astrocytic tumour and its correlation with O6-methylguanine-DNA methyltransferase (MGMT) expression.
26211580 2015 The association of DNA methyltransferase 1 gene polymorphisms with susceptibility to childhood acute lymphoblastic leukemia.
26162541 2015 The possible role of EZH2 and DNMT1 polymorphisms in sporadic triple-negative breast carcinoma in southern Chinese females.
26139044 2015 Obesity-induced DNA hypermethylation of the adiponectin gene mediates insulin resistance.
26120002 2015 DNA Electrochemistry Shows DNMT1 Methyltransferase Hyperactivity in Colorectal Tumors.
26090723 2015 DNMT1-dependent suppression of microRNA424 regulates tumor progression in human bladder cancer.
26085088 2015 The DNA Methyltransferase DNMT1 and Tyrosine-Protein Kinase KIT Cooperatively Promote Resistance to 5-Aza-2'-deoxycytidine (Decitabine) and Midostaurin (PKC412) in Lung Cancer Cells.
26070743 2015 Crystal Structure of Human DNA Methyltransferase 1.
26056945 2015 Piwil1 causes epigenetic alteration of PTEN gene via upregulation of DNA methyltransferase in type I endometrial cancer.
25990724 2015 Small RNA-mediated DNA (cytosine-5) methyltransferase 1 inhibition leads to aberrant DNA methylation.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25960197 2015 Molecular mechanism for USP7-mediated DNMT1 stabilization by acetylation.
25950085 2015 The Interplay Between miR-148a and DNMT1 Might be Exploited for Pancreatic Cancer Therapy.
25948775 2015 Consequences of combining siRNA-mediated DNA methyltransferase 1 depletion with 5-aza-2'-deoxycytidine in human leukemic KG1 cells.
25927928 2015 miR-148b reverses cisplatin-resistance in non-small cell cancer cells via negatively regulating DNA (cytosine-5)-methyltransferase 1(DNMT1) expression.
25908435 2015 DNMT1 is essential for mammary and cancer stem cell maintenance and tumorigenesis.
25899090 2015 Hypermethylation of glucocorticoid receptor gene promoter results in glucocorticoid receptor gene low expression in peripheral blood mononuclear cells of patients with systemic lupus erythematosus.
25892014 2015 Epigenetic repression of Krüppel-like factor 4 through Dnmt1 contributes to EMT in renal fibrosis.
25888794 2015 Identification and characterization of DNAzymes targeting DNA methyltransferase I for suppressing bladder cancer proliferation.
25886188 2015 Methylation of RASSF1A gene promoter and the correlation with DNMT1 expression that may contribute to esophageal squamous cell carcinoma.
25865490 2016 miR-148a dependent apoptosis of bladder cancer cells is mediated in part by the epigenetic modifier DNMT1.
25854163 2015 MRTF-A and STAT3 promote MDA-MB-231 cell migration via hypermethylating BRSM1.
25822089 2015 Targeted disruption of DNMT1, DNMT3A and DNMT3B in human embryonic stem cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25753001 2015 A Protein Interaction between ?-Catenin and Dnmt1 Regulates Wnt Signaling and DNA Methylation in Colorectal Cancer Cells.
25746661 2015 Deregulation of DNMT1, DNMT3B and miR-29s in Burkitt lymphoma suggests novel contribution for disease pathogenesis.
25738352 2015 Correlation between the expression of DNMT1, and GSTP1 and APC, and the methylation status of GSTP1 and APC in association with their clinical significance in prostate cancer.
25700986 2015 DNA methyl transferase 1 reduces expression of SRD5A2 in the aging adult prostate.
25678562 2015 Defects of mutant DNMT1 are linked to a spectrum of neurological disorders.
25596970 2015 Association of DNMT1 Gene Polymorphisms with Congenital Heart Disease in Child Patients.
25595591 2015 DNMT1 and EZH2 mediated methylation silences the microRNA-200b/a/429 gene and promotes tumor progression.
25550796 2014 Expression profiling and clinicopathological significance of DNA methyltransferase 1, 3A and 3B in sporadic human renal cell carcinoma.
25547067 2015 Ursolic acid inhibited growth of hepatocellular carcinoma HepG2 cells through AMPK?-mediated reduction of DNA methyltransferase 1.
25512445 2015 DNMT1-microRNA126 epigenetic circuit contributes to esophageal squamous cell carcinoma growth via ADAM9-EGFR-AKT signaling.
25476119 2015 DNA-methyltransferase1 (DNMT1) binding to CpG rich GABAergic and BDNF promoters is increased in the brain of schizophrenia and bipolar disorder patients.
25461380 2015 Increased DNA methyltransferase 1 protein expression correlates significantly with intestinal histological type and gender in gastric carcinomas.
25455074 2014 RB maintains quiescence and prevents premature senescence through upregulation of DNMT1 in mesenchymal stromal cells.
25452147 2015 Global changes in DNA methylation in Alzheimer's disease peripheral blood mononuclear cells.
25451918 2015 Topoisomerase II regulates the maintenance of DNA methylation.
25444908 2015 ?-Arrestin1 promotes the self-renewal of the leukemia-initiating cell-enriched subpopulation in B-lineage acute lymphoblastic leukemia related to DNMT1 activity.
25420499 2015 Mechanistic and biological significance of DNA methyltransferase 1 upregulated by growth factors in human hepatocellular carcinoma.
25389112 2015 DNA methyltransferase 1 drives transcriptional down-modulation of ? catenin antagonist Chibby1 associated with the BCR-ABL1 gene of chronic myeloid leukemia.
25378232 2014 B-RafV600E inhibits sodium iodide symporter expression via regulation of DNA methyltransferase 1.
25349215 2015 Does Wnt/?-catenin pathway contribute to the stability of DNMT1 expression in urological cancer cell lines?
25319390 2014 miR-185 suppresses tumor proliferation by directly targeting E2F6 and DNMT1 and indirectly upregulating BRCA1 in triple-negative breast cancer.
25315069 2015 ?EF1 associates with DNMT1 and maintains DNA methylation of the E-cadherin promoter in breast cancer cells.
25284287 2014 Inhibition of bladder cancer invasion by Sp1-mediated BTG2 expression via inhibition of DNA methyltransferase 1.
25231260 2014 A miR-199a/miR-214 self-regulatory network via PSMD10, TP53 and DNMT1 in testicular germ cell tumor.
25207720 2014 Luteolin induces apoptosis in BE colorectal cancer cells by downregulating calpain, UHRF1, and DNMT1 expressions.
25189999 2014 Reversible epigenetic regulation of 14-3-3? expression in acquired gemcitabine resistance by uhrf1 and DNA methyltransferase 1.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25038421 2014 DNA methyltransferase haplotype is associated with Alzheimer's disease.
25033457 2014 Aberrant signature methylome by DNMT1 hot spot mutation in hereditary sensory and autonomic neuropathy 1E.
25015109 2014 A nucleolin-DNMT1 regulatory axis in acute myeloid leukemogenesis.
25004396 2014 MicroRNA profiling of novel African American and Caucasian Prostate Cancer cell lines reveals a reciprocal regulatory relationship of miR-152 and DNA methyltranferase 1.
24947242 2015 IL-6 enriched lung cancer stem-like cell population by inhibition of cell cycle regulators via DNMT1 upregulation.
24913034 2014 Decreased miR-30b-5p expression by DNMT1 methylation regulation involved in gastric cancer metastasis.
24911372 2014 miR-185 inhibits hepatocellular carcinoma growth by targeting the DNMT1/PTEN/Akt pathway.
24875904 2014 RANKL expression in myeloma cells is regulated by a network involving RANKL promoter methylation, DNMT1, microRNA and TNF? in the microenvironment.
24859147 2014 DNA methyl transferase (DNMT) gene polymorphisms could be a primary event in epigenetic susceptibility to schizophrenia.
24833086 2014 A new tumor suppressor LncRNA ADAMTS9-AS2 is regulated by DNMT1 and inhibits migration of glioma cells.
24714841 2014 MicroRNA-148a is silenced by hypermethylation and interacts with DNA methyltransferase 1 in hepatocellular carcinogenesis.
24675762 2014 Kaposi's sarcoma-associated herpesvirus (KSHV) vIL-6 promotes cell proliferation and migration by upregulating DNMT1 via STAT3 activation.
24637615 2014 The DNMT1/PCNA/UHRF1 disruption induces tumorigenesis characterized by similar genetic and epigenetic signatures.
24631383 2014 Polymorphism in DNMT1 may modify the susceptibility to oligospermia.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
24532244 2014 Targeted mutagenesis results in an activation of DNA methyltransferase 1 and confirms an autoinhibitory role of its RFTS domain.
24515776 2014 MiR-148a regulates MEG3 in gastric cancer by targeting DNA methyltransferase 1.
24502362 2014 Regulation of DNA methyltransferase 1 transcription in BRCA1-mutated breast cancer: a novel crosstalk between E2F1 motif hypermethylation and loss of histone H3 lysine 9 acetylation.
24492612 2014 Methyllysine reader plant homeodomain (PHD) finger protein 20-like 1 (PHF20L1) antagonizes DNA (cytosine-5) methyltransferase 1 (DNMT1) proteasomal degradation.
24475290 2014 Inhibition of HDAC1 and DNMT1 modulate RGS10 expression and decrease ovarian cancer chemoresistance.
24464625 2015 DNA methyltransferase 1/3a overexpression in sporadic breast cancer is associated with reduced expression of estrogen receptor-alpha/breast cancer susceptibility gene 1 and poor prognosis.
24459426 2013 Association of self-DNA mediated TLR9-related gene, DNA methyltransferase, and cytokeratin protein expression alterations in HT29-cells to DNA fragment length and methylation status.
24449497 2014 Epigenetic reprogramming modulates malignant properties of human liver cancer.
24441913 2014 5-aza-2'-Deoxycytidine, a DNA methyltransferase inhibitor, facilitates the inorganic phosphorus-induced mineralization of vascular smooth muscle cells.
24434851 2014 MBD4 cooperates with DNMT1 to mediate methyl-DNA repression and protects mammalian cells from oxidative stress.
24389641 2014 Regulation of protein stability of DNA methyltransferase 1 by post-translational modifications.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247422 2014 Upregulation of DNMT1 mediated by HBx suppresses RASSF1A expression independent of DNA methylation.
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
24107992 2013 DNMT1-interacting RNAs block gene-specific DNA methylation.
24098518 2013 Influence of DNMT genotype on global and site specific DNA methylation patterns in neonates and pregnant women.
24094292 2013 DNMT1 and AIM1 Imprinting in human placenta revealed through a genome-wide screen for allele-specific DNA methylation.
24038143 2013 The E2F1/DNMT1 axis is associated with the development of AR negative castration resistant prostate cancer.
24013172 2013 Uhrf1-dependent H3K23 ubiquitylation couples maintenance DNA methylation and replication.
24001151 2013 Mahanine restores RASSF1A expression by down-regulating DNMT1 and DNMT3B in prostate cancer cells.
23990460 2013 Functional specificity of CpG DNA-binding CXXC domains in mixed lineage leukemia.
23957506 2013 Plasma S-adenosylmethionine, DNMT polymorphisms, and peripheral blood LINE-1 methylation among healthy Chinese adults in Singapore.
23938174 2013 DNA-methylation gene network dysregulation in peripheral blood lymphocytes of schizophrenia patients.
23918933 2013 Regulatory interaction between NBS1 and DNMT1 responding to DNA damage.
23918800 2013 Molecular mechanism of SLC5A8 inactivation in breast cancer.
23867713 2013 Role of DNA methyltransferase 1 on the altered eNOS expression in human umbilical endothelium from intrauterine growth restricted fetuses.
23846337 2013 GKN1-miR-185-DNMT1 axis suppresses gastric carcinogenesis through regulation of epigenetic alteration and cell cycle.
23820632 2013 Association between mRNA levels of DNMT1, DNMT3A, DNMT3B, MBD2 and LINE-1 methylation status in infants with tetralogy of Fallot.
23775084 2013 The catalytic subunit of protein phosphatase 2A (PP2Ac) promotes DNA hypomethylation by suppressing the phosphorylated mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) kinase (MEK)/phosphorylated ERK/DNMT1 protein pathway in T-cells from controls and systemic lupus erythematosus patients.
23771421 Lack of association between DNMT1 gene polymorphisms and noise-induced hearing loss in a Chinese population.
23706494 2013 Ultraviolet B enhances DNA hypomethylation of CD4+ T cells in systemic lupus erythematosus via inhibiting DNMT1 catalytic activity.
23671287 2013 Identification of DNMT1 selective antagonists using a novel scintillation proximity assay.
23666104 2013 DNMT1, DNMT3A and DNMT3B gene variants in relation to ovarian cancer risk in the Polish population.
23652987 2013 The role of a ginseng saponin metabolite as a DNA methyltransferase inhibitor in colorectal cancer cells.
23624957 2013 Holocarboxylase synthetase synergizes with methyl CpG binding protein 2 and DNA methyltransferase 1 in the transcriptional repression of long-terminal repeats.
23549984 2013 MicroRNA-148a can regulate runt-related transcription factor 3 gene expression via modulation of DNA methyltransferase 1 in gastric cancer.
23545144 2013 DNA methyltransferases 1 and 3B are required for hepatitis C virus infection in cell culture.
23478041 2013 Epigenetic dysregulation in salivary glands from patients with primary Sjögren's syndrome may be ascribed to infiltrating B cells.
23463006 2013 UHRF1 targets DNMT1 for DNA methylation through cooperative binding of hemi-methylated DNA and methylated H3K9.
23393137 2013 DNA 5-methylcytosine demethylation activities of the mammalian DNA methyltransferases.
23365052 2013 DNMT1 mutation hot spot causes varied phenotypes of HSAN1 with dementia and hearing loss.
23364257 2012 Chemotherapy and radiotherapy downregulate the activity and expression of DNA methyltransferase and enhance Bcl-2/E1B-19-kDa interacting protein-3-induced apoptosis in human colorectal cancer cells.
23318422 2014 MiR-152 and miR-185 co-contribute to ovarian cancer cells cisplatin sensitivity by targeting DNMT1 directly: a novel epigenetic therapy independent of decitabine.
23254386 2013 Increased levels of DNA methyltransferases are associated with the tumorigenic capacity of prostate cancer cells.
23249948 2013 HBP1-mediated transcriptional regulation of DNA methyltransferase 1 and its impact on cell senescence.
23242655 2013 Mutant p53 binds to estrogen receptor negative promoter via DNMT1 and HDAC1 in MDA-MB-468 breast cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23127209 2013 Associations between aberrant DNA methylation and transcript levels of DNMT1 and MBD2 in CD4+T cells from patients with systemic lupus erythematosus.
23125218 2013 MicroRNA-152 targets DNA methyltransferase 1 in NiS-transformed cells via a feedback mechanism.
23079992 2012 Association of DNMT1 and DNMT3B polymorphisms with breast cancer risk in Han Chinese women from South China.
23072722 2013 Loss of LSD1 (lysine-specific demethylase 1) suppresses growth and alters gene expression of human colon cancer cells in a p53- and DNMT1(DNA methyltransferase 1)-independent manner.
23064049 2013 DNA methyltransferase 1 is essential for initiation of the colon cancers.
23049933 2012 Polymorphisms of the DNA methyltransferase 1 associated with reduced risks of Helicobacter pylori infection and increased risks of gastric atrophy.
23041765 2012 Ciprofloxacin has antifibrotic effects in scleroderma fibroblasts via downregulation of Dnmt1 and upregulation of Fli1.
23039890 2012 Association of polymorphisms in DNMT1, DNMT3A, DNMT3B, MTHFR and MTRR genes with global DNA methylation levels and prognosis of autoimmune thyroid disease.
22975348 2012 ER? positively regulated DNMT1 expression by binding to the gene promoter region in human breast cancer MCF-7 cells.
22942708 2012 Risk-association of DNA methyltransferases polymorphisms with gastric cancer in the Southern Chinese population.
22898998 2013 MicroRNA-140 acts as a liver tumor suppressor by controlling NF-?B activity by directly targeting DNA methyltransferase 1 (Dnmt1) expression.
22894906 2012 An insight into the various regulatory mechanisms modulating human DNA methyltransferase 1 stability and function.
22879518 2013 Epigenetic modification of liver mitochondrial DNA is associated with histological severity of nonalcoholic fatty liver disease.
22795133 2012 Oct4 and Nanog directly regulate Dnmt1 to maintain self-renewal and undifferentiated state in mesenchymal stem cells.
22768205 2012 Clinicopathological significance and prognostic value of DNA methyltransferase 1, 3a, and 3b expressions in sporadic epithelial ovarian cancer.
22739025 2012 IL-6-induced DNMT1 activity mediates SOCS3 promoter hypermethylation in ulcerative colitis-related colorectal cancer.
22547080 2012 Pregnancy and the methyltransferase genotype independently influence the arsenic methylation phenotype.
22520950 2012 Clinicopathologic significance of DNA methyltransferase 1, 3a, and 3b overexpression in Tunisian breast cancers.
22455563 2012 The expression patterns and correlations of claudin-6, methy-CpG binding protein 2, DNA methyltransferase 1, histone deacetylase 1, acetyl-histone H3 and acetyl-histone H4 and their clinicopathological significance in breast invasive ductal carcinomas.
22403725 2012 Methylation of Wnt7a is modulated by DNMT1 and cigarette smoke condensate in non-small cell lung cancer.
22362755 2012 Zinc-induced Dnmt1 expression involves antagonism between MTF-1 and nuclear receptor SHP.
22349384 2012 [Expression of DNMT1, DNMT3a, and DNMT3b in eutopic endometrium].
22328086 2012 Mutations in DNMT1 cause autosomal dominant cerebellar ataxia, deafness and narcolepsy.
22323818 2012 Structure-based mechanistic insights into DNMT1-mediated maintenance DNA methylation.
22317856 2012 The tobacco-specific carcinogen NNK induces DNA methyltransferase 1 accumulation in laryngeal carcinoma.
22301400 2012 Association of increased DNA methyltransferase expression with carcinogenesis and poor prognosis in pancreatic ductal adenocarcinoma.
22295098 2012 MicroRNA-152 mediates DNMT1-regulated DNA methylation in the estrogen receptor ? gene.
22264301 2012 Concurrent hypermethylation of DNMT1, MGMT and EGFR genes in progression of gliomas.
22236544 2012 DNMT3B (C46359T) polymorphisms and immunoexpression of DNMT3b and DNMT1 proteins in oral lichen planus.
22219193 2012 Regulation of human RNA polymerase III transcription by DNMT1 and DNMT3a DNA methyltransferases.
22167392 2012 MicroRNA-148a is silenced by hypermethylation and interacts with DNA methyltransferase 1 in gastric cancer.
22110720 2011 Expression of DNMT1 and DNMT3a are regulated by GLI1 in human pancreatic cancer.
22094255 2011 Oxidative damage targets complexes containing DNA methyltransferases, SIRT1, and polycomb members to promoter CpG Islands.
22072770 2012 Contributions of CTCF and DNA methyltransferases DNMT1 and DNMT3B to Epstein-Barr virus restricted latency.
22048249 2011 DNA methylation imprinting marks and DNA methyltransferase expression in human spermatogenic cell stages.
21999220 2011 Effects of DNMT1 silencing on malignant phenotype and methylated gene expression in cervical cancer cells.
21966451 2011 Repression of androgen receptor transcription through the E2F1/DNMT1 axis.
21962230 2011 MiR-185 targets the DNA methyltransferases 1 and regulates global DNA methylation in human glioma.
21947282 2011 SIRT1 deacetylates the DNA methyltransferase 1 (DNMT1) protein and alters its activities.
21887463 2012 Transcriptional analysis of CXCR4, DNMT3A, DNMT3B and DNMT1 gene expression in primary advanced uterine cervical carcinoma.
21826395 2012 Increased expression of DNA methyltransferase 1 and 3a in human temporal lobe epilepsy.
21791605 2011 Genomic DNA hypomethylation by histone deacetylase inhibition implicates DNMT1 nuclear dynamics.
21757290 2011 Hepatitis C virus Core protein stimulates cell growth by down-regulating p16 expression via DNA methylation.
21756783 2011 [Role of poly (ADP-ribose) polymerase 1 on DNA methylation variation induced by B(a)P in human bronchial epithelial cell].
21745816 2011 The USP7/Dnmt1 complex stimulates the DNA methylation activity of Dnmt1 and regulates the stability of UHRF1.
21735817 2011 [Cytosine methylation in DNA and its role in cancer therapy].
21636528 2011 DNMT1 deficiency triggers mismatch repair defects in human cells through depletion of repair protein levels in a process involving the DNA damage response.
21619587 2011 PKC isoforms interact with and phosphorylate DNMT1.
21592522 2011 State-dependent changes in the expression of DNA methyltransferases in mood disorder patients.
21573703 2011 Silencing of BNIP3 results from promoter methylation by DNA methyltransferase 1 induced by the mitogen-activated protein kinase pathway.
21565830 2011 MicroRNA-342 inhibits colorectal cancer cell proliferation and invasion by directly targeting DNA methyltransferase 1.
21565170 2011 Phosphorylation of human DNMT1: implication of cyclin-dependent kinases.
21539677 2011 Effects of DNA methyltransferase 1 inhibition on esophageal squamous cell carcinoma.
21532572 2011 Mutations in DNMT1 cause hereditary sensory neuropathy with dementia and hearing loss.
21523767 2011 Expression and function role of DNA methyltransferase 1 in human bladder cancer.
21478913 2011 Inhibition of p53 represses E-cadherin expression by increasing DNA methyltransferase-1 and promoter methylation in serous borderline ovarian tumor cells.
21459093 2011 Nuclear receptor SHP inhibition of Dnmt1 expression via ERR?.
21458988 2011 DNA methyltransferase 1 as a predictive biomarker and potential therapeutic target for chemotherapy in gastric cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21395176 2010 [The expression of DNMT1 in laryngeal squamous cell carcinoma and its clinical significance].
21389349 2011 The replication focus targeting sequence (RFTS) domain is a DNA-competitive inhibitor of Dnmt1.
21353307 2011 Interleukin-6 expression was regulated by epigenetic mechanisms in response to influenza virus infection or dsRNA treatment.
21347439 2011 Transcriptional repressive H3K9 and H3K27 methylations contribute to DNMT1-mediated DNA methylation recovery.
21321201 2011 DNA methyltransferase 1, cytosine methylation, and cytosine hydroxymethylation in mammalian mitochondria.
21316665 2011 Deoxyribonucleic acid methyltransferases and methyl-CpG-binding domain proteins in human endometrium and endometriosis.
21311766 2011 Different binding properties and function of CXXC zinc finger domains in Dnmt1 and Tet1.
21296890 2011 Alpha-synuclein sequesters Dnmt1 from the nucleus: a novel mechanism for epigenetic alterations in Lewy body diseases.
21269460 2011 Initial characterization of the human central proteome.
21268065 2011 Usp7 and Uhrf1 control ubiquitination and stability of the maintenance DNA methyltransferase Dnmt1.
21266713 2011 Control of DNMT1 abundance in epigenetic inheritance by acetylation, ubiquitylation, and the histone code.
21229291 2011 Epigenetic regulation of DNA methyltransferases: DNMT1 and DNMT3B in gliomas.
21163962 2011 Structure of DNMT1-DNA complex reveals a role for autoinhibition in maintenance DNA methylation.
21151116 2011 A methylation and phosphorylation switch between an adjacent lysine and serine determines human DNMT1 stability.
21078759 2011 Global DNA methylation, DNMT1, and MBD2 in patients with systemic lupus erythematosus.
21045206 2010 DNMT1 stability is regulated by proteins coordinating deubiquitination and acetylation-driven ubiquitination.
21042757 2010 HPV-16 E6 upregulation of DNMT1 through repression of tumor suppressor p53.
20980350 2011 Effects of specific DNMT gene depletion on cancer cell transformation and breast cancer cell invasion; toward selective DNMT inhibitors.
20970125 2011 Expression and regulation of DNA methyltransferases in human endometrium.
20951977 2010 Immunohistochemical expression of DNA methyltransferases 1, 3a and 3b in oral leukoplakias and squamous cell carcinomas.
20940144 2011 Rapid and transient recruitment of DNMT1 to DNA double-strand breaks is mediated by its interaction with multiple components of the DNA damage response machinery.
20937307 2011 Global DNA methylation, DNMT1, and MBD2 in patients with rheumatoid arthritis.
20920981 2010 Association of DNMT1 gene polymorphisms in exons with sporadic infiltrating ductal breast carcinoma among Chinese Han women in the Heilongjiang Province.
20875141 2010 Short-hairpin RNA-induced suppression of adenine nucleotide translocase-2 in breast cancer cells restores their susceptibility to TRAIL-induced apoptosis by activating JNK and modulating TRAIL receptor expression.
20840813 2010 [High expression of DNMT1 was correlated with beta-catenin accumulation and malignant phynotype of lung squamous cell carcinoma and adenocarcinoma].
20620135 2010 Hepatitis B virus X protein promotes hypermethylation of p16(INK4A) promoter through upregulation of DNA methyltransferases in hepatocarcinogenesis.
20613874 2010 Disruption of Dnmt1/PCNA/UHRF1 interactions promotes tumorigenesis from human and mice glial cells.
20593030 2010 Human intelligence and polymorphisms in the DNA methyltransferase genes involved in epigenetic marking.
20592467 2010 hNaa10p contributes to tumorigenesis by facilitating DNMT1-mediated tumor suppressor gene silencing.
20588031 2010 Increased expression of DNA methyltransferase-1 in non-neoplastic epithelium helps predict colorectal neoplasia risk in ulcerative colitis.
20570896 2010 Dysregulation of p53/Sp1 control leads to DNA methyltransferase-1 overexpression in lung cancer.
20428781 2010 DNA methyltransferase 3-like affects promoter methylation of thymine DNA glycosylase independently of DNMT1 and DNMT3B in cancer cells.
20398055 2010 DNMT1 and DNMT3b silencing sensitizes human hepatoma cells to TRAIL-mediated apoptosis via up-regulation of TRAIL-R2/DR5 and caspase-8.
20381114 2010 DNA methyltransferases 1, 3a, and 3b overexpression and clinical significance in gastroenteropancreatic neuroendocrine tumors.
20354000 2010 Upregulation of DNA methyltransferase-mediated gene silencing, anchorage-independent growth, and migration of colon cancer cells by interleukin-6.
20335008 2010 Varenicline treatment decreases DNMT1 mRNA expression in lymphocytes of schizophrenic patients who are cigarette smokers.
20228804 2010 Dnmt1 and Dnmt3a maintain DNA methylation and regulate synaptic function in adult forebrain neurons.
20192608 2009 Lack of effects of single nucleotide polymorphisms of the DNA methyltransferase 1 gene on gastric cancer in Iranian patients: a case control study.
20192566 2009 Effects of amino acid substitution polymorphisms of two DNA methyltransferases on susceptibility to sporadic colorectal cancer.
20147412 2010 Hepatitis B virus replication induces methylation of both host and viral DNA.
20093774 2010 The tobacco-specific carcinogen NNK induces DNA methyltransferase 1 accumulation and tumor suppressor gene hypermethylation in mice and lung cancer patients.
20081831 2010 DNMT1 maintains progenitor function in self-renewing somatic tissue.
20071580 2010 Epigenetic regulation of Kaposi's sarcoma-associated herpesvirus latency by virus-encoded microRNAs that target Rta and the cellular Rbl2-DNMT pathway.
20071334 2010 DNA methylation-mediated down-regulation of DNA methyltransferase-1 (DNMT1) is coincident with, but not essential for, global hypomethylation in human placenta.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20044957 2009 Putative association of DNA methyltransferase 1 (DNMT1) polymorphisms with clearance of HBV infection.
19957555 2009 [Effect of DNA methyltransferase 1 gene silencing on proliferation and apoptosis of HeLa cells].
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19932585 2010 Increased CXCR4 expression in AsPC1 pancreatic carcinoma cells with RNA interference-mediated knockdown of DNMT1 and DNMT3B.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19798569 2010 Two-stage case-control study of DNMT-1 and DNMT-3B gene variants and breast cancer risk.
19798101 2009 Np95 interacts with de novo DNA methyltransferases, Dnmt3a and Dnmt3b, and mediates epigenetic silencing of the viral CMV promoter in embryonic stem cells.
19763880 2010 DNA methyltransferase expression differs with proliferation in childhood acute lymphoblastic leukemia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19539327 2009 DNMT1 silencing affects locus specific DNA methylation and increases prostate cancer derived PC3 cell invasiveness.
19531770 2009 Differential repetitive DNA methylation in multiple myeloma molecular subgroups.
19468253 2009 Immunolocalization of DNMT1 and DNMT3a in salivary gland neoplasms.
19465937 2009 DNA methyltransferase-mediated transcriptional silencing in malignant glioma: a combined whole-genome microarray and promoter array analysis.
19450230 2009 SUMOylation enhances DNA methyltransferase 1 activity.
19424621 2009 Significance of DNA methyltransferase-1 and histone deacetylase-1 in pancreatic cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19399937 2009 Overexpression of DNA methyltransferase 1 and its biological significance in primary hepatocellular carcinoma.
19399408 2009 Effects on biological behavior of bladder carcinoma T24 cells via silencing DNMT1 and/or DNMT3b with shRNA in vitro.
19394279 2009 Decreased DNA methyltransferase levels contribute to abnormal gene expression in "senescent" CD4(+)CD28(-) T cells.
19386473 2009 An upregulation of DNA-methyltransferase 1 and 3a expressed in telencephalic GABAergic neurons of schizophrenia patients is also detected in peripheral blood lymphocytes.
19339266 2009 Activation of DNA methyltransferase 1 by EBV latent membrane protein 2A leads to promoter hypermethylation of PTEN gene in gastric carcinoma.
19292979 2009 DNA methyltransferase I is a mediator of doxorubicin-induced genotoxicity in human cancer cells.
19282482 2009 Regulation of DNMT1 stability through SET7-mediated lysine methylation in mammalian cells.
19279403 2009 Panobinostat treatment depletes EZH2 and DNMT1 levels and enhances decitabine mediated de-repression of JunB and loss of survival of human acute leukemia cells.
19275888 2009 p21(WAF1) negatively regulates DNMT1 expression in mammalian cells.
19246518 2009 A systematic search for DNA methyltransferase polymorphisms reveals a rare DNMT3L variant associated with subtelomeric hypomethylation.
19236003 2009 6-Thioguanine perturbs cytosine methylation at the CpG dinucleotide site by DNA methyltransferases in vitro and acts as a DNA demethylating agent in vivo.
19211935 2009 MicroRNA-29b induces global DNA hypomethylation and tumor suppressor gene reexpression in acute myeloid leukemia by targeting directly DNMT3A and 3B and indirectly DNMT1.
19173286 2009 Dimerization of DNA methyltransferase 1 is mediated by its regulatory domain.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19019634 2009 The effect of DNMTs and MBPs on hypomethylation in systemic lupus erythematosus.
19016755 2008 Interaction between DNMT1 and DNA replication reactions in the SV40 in vitro replication system.
18931722 2008 [Gene expressions of DNA methyltransferase 1 and human leukocyte antigen-DRalpha in hepatocelluar carcinoma and their clinical significance].
18829110 2009 Aberrant promotor methylation in MDS hematopoietic cells during in vitro lineage specific differentiation is differently associated with DNMT isoforms.
18754681 2008 CXXC domain of human DNMT1 is essential for enzymatic activity.
18680430 2008 CFP1 interacts with DNMT1 independently of association with the Setd1 Histone H3K4 methyltransferase complexes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18567946 The early expressed HIV-1 genes regulate DNMT1 expression.
18563322 2008 Suppressing effects of down-regulating DNMT1 and DNMT3b expression on the growth of human cholangiocarcinoma cell line.
18505931 2008 Inhibition of histone deacetylases promotes ubiquitin-dependent proteasomal degradation of DNA methyltransferase 1 in human breast cancer cells.
18499700 2008 Haplotypes of DNMT1 and DNMT3B are associated with mutagen sensitivity induced by benzo[a]pyrene diol epoxide among smokers.
18438403 2008 Protein lysine methyltransferase G9a acts on non-histone targets.
18414412 2008 Expression of methylation-related genes is associated with overall survival in patients with non-small cell lung cancer.
18413740 2008 DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation.
18404674 2008 Hypermethylation of RAS effector related genes and DNA methyltransferase 1 expression in endometrial carcinogenesis.
18253830 2008 The expression and clinical significance of DNA methyltransferase proteins in human gastric cancer.
18252747 2008 Dnmt1 deficiency promotes CAG repeat expansion in the mouse germline.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18204201 IL-6 enhances the nuclear translocation of DNA cytosine-5-methyltransferase 1 (DNMT1) via phosphorylation of the nuclear localization sequence by the AKT kinase.
18202356 2008 Parental effect of DNA (Cytosine-5) methyltransferase 1 on grandparental-origin-dependent transmission ratio distortion in mouse crosses and human families.
18198215 2008 15-Lipoxygenase-1 transcriptional silencing by DNA methyltransferase-1 independently of DNA methylation.
18194272 2008 Transcript levels of DNA methyltransferases DNMT1, DNMT3A and DNMT3B in CD4+ T cells from patients with systemic lupus erythematosus.
18049164 2007 DNA methyltransferase 1 knockdown induces silenced CDH1 gene reexpression by demethylation of methylated CpG in hepatocellular carcinoma cell line SMMC-7721.
18038118 2008 DNA (cytosine-5)-methyltransferase 1 as a mediator of mutant p53-determined p16(ink4A) down-regulation.
17994007 2007 The SRA protein Np95 mediates epigenetic inheritance by recruiting Dnmt1 to methylated DNA.
17991895 2008 DNA methylation inhibitor 5-Aza-2'-deoxycytidine induces reversible genome-wide DNA damage that is distinctly influenced by DNA methyltransferases 1 and 3B.
17972916 2007 RIP140 directs histone and DNA methylation to silence Ucp1 expression in white adipocytes.
17965595 Reviewing the role of DNA (cytosine-5) methyltransferase overexpression in the cortical GABAergic dysfunction associated with psychosis vulnerability.
17934516 2008 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression.
17931718 2008 DNMT1 interacts with the developmental transcriptional repressor HESX1.
17893234 2007 Alterations of DNA methylation associated with abnormalities of DNA methyltransferases in human cancers during transition from a precancerous to a malignant state.
17716861 2007 Phosphatidylinositol 3-kinase/protein kinase B pathway stabilizes DNA methyltransferase I protein and maintains DNA methylation.
17698033 2007 Mahanine reverses an epigenetically silenced tumor suppressor gene RASSF1A in human prostate cancer cells.
17673620 2007 UHRF1 plays a role in maintaining DNA methylation in mammalian cells.
17657744 2007 Association of the SUV39H1 histone methyltransferase with the DNA methyltransferase 1 at mRNA expression level in primary colorectal cancer.
17538945 2007 Progressive up-regulation of genes encoding DNA methyltransferases in the colorectal adenoma-carcinoma sequence.
17532557 2007 RNA interference-mediated knockdown of DNMT1 and DNMT3B induces CXCL12 expression in MCF-7 breast cancer and AsPC1 pancreatic carcinoma cell lines.
17492476 2008 Prevalence of ZAP-70, LAT, SLP-76, and DNA methyltransferase 1 expression in CD4+ T cells of patients with systemic lupus erythematosus.
17470536 2007 Functional cooperation between HP1 and DNMT1 mediates gene silencing.
17359920 2007 Covalent modification of DNA regulates memory formation.
17322882 2007 Complete inactivation of DNMT1 leads to mitotic catastrophe in human cancer cells.
17312023 2007 DNMT1 but not its interaction with the replication machinery is required for maintenance of DNA methylation in human cells.
17200670 2007 Polycomb-mediated methylation on Lys27 of histone H3 pre-marks genes for de novo methylation in cancer.
17178861 2006 Activation of DNA methyltransferase 1 by EBV LMP1 Involves c-Jun NH(2)-terminal kinase signaling.
17093909 2007 Expression of human DNA methyltransferase 1 in colorectal cancer tissues and their corresponding distant normal tissues.
17085482 2006 Direct interaction between DNMT1 and G9a coordinates DNA and histone methylation during replication.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081533 2007 Aberrant expression of deoxyribonucleic acid methyltransferases DNMT1, DNMT3A, and DNMT3B in women with endometriosis.
17067458 2006 [Expression of DNA methyltransferases in salivary adenoid cystic carcinoma and its association with the CpG islands methylation of tumor suppressor genes].
17053888 2007 Different susceptibility of increased DNMT1 expression by exposure to tobacco smoke according to histology in primary non-small cell lung cancer.
17030625 2007 AUF1 cell cycle variations define genomic DNA methylation by regulation of DNMT1 mRNA stability.
17015478 2006 DNA methyltransferase 1 knockdown activates a replication stress checkpoint.
16998846 2007 Sex-specific windows for high mRNA expression of DNA methyltransferases 1 and 3A and methyl-CpG-binding domain proteins 2 and 4 in human fetal gonads.
16963560 2006 Identification of DNMT1 (DNA methyltransferase 1) hypomorphs in somatic knockouts suggests an essential role for DNMT1 in cell survival.
16960727 2007 DNMT1 and HDAC1 gene expression in impaired spermatogenesis and testicular cancer.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16897079 2006 Expression of DNMT-1 in patients with atopic dermatitis.
16861352 2006 STAT3 induces transcription of the DNA methyltransferase 1 gene (DNMT1) in malignant T lymphocytes.
16801630 2006 Overcoming resistance to interferon-induced apoptosis of renal carcinoma and melanoma cells by DNA demethylation.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16769694 2005 XIST repression in the absence of DNMT1 and DNMT3B.
16537562 2006 DNA methylation of multiple tumor-related genes in association with overexpression of DNA methyltransferase 1 (DNMT1) during multistage carcinogenesis of the pancreas.
16497664 2006 Transient down-regulation of DNMT1 methyltransferase leads to activation and stable hypomethylation of MAGE-A1 in melanoma cells.
16424002 2006 Differential requirement for DNA methyltransferase 1 in maintaining human cancer cell gene promoter hypermethylation.
16423997 2006 De novo CpG island methylation in human cancer cells.
16357870 2006 The Polycomb group protein EZH2 directly controls DNA methylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322686 2006 Loss of DNA methylation and histone H4 lysine 20 trimethylation in human breast cancer cells is associated with aberrant expression of DNA methyltransferase 1, Suv4-20h2 histone methyltransferase and methyl-binding proteins.
16314526 2005 Association of BMI1 with polycomb bodies is dynamic and requires PRC2/EZH2 and the maintenance DNA methyltransferase DNMT1.
16227093 2005 RNAi and RNA-based regulation of immune system function.
16053511 2005 Increased DNA methyltransferase 1 (DNMT1) protein expression in precancerous conditions and ductal carcinomas of the pancreas.
15956212 2005 Recruitment of DNA methyltransferase I to DNA repair sites.
15870198 2005 STAT3- and DNA methyltransferase 1-mediated epigenetic silencing of SHP-1 tyrosine phosphatase tumor suppressor gene in malignant T lymphocytes.
15799776 2005 The de novo methylation activity of Dnmt3a is distinctly different than that of Dnmt1.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15762053 Increased DNA methyltransferase 1 (DNMT1) gene expression in human lymphomas by fluorescent in situ hybridization.
15755728 2005 Increased protein stability causes DNA methyltransferase 1 dysregulation in breast cancer.
15735013 2005 Interplay of RUNX1/MTG8 and DNA methyltransferase 1 in acute myeloid leukemia.
15696166 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing.
15684088 2005 In psychosis, cortical interneurons overexpress DNA-methyltransferase 1.
15657147 2005 Human maintenance DNA (cytosine-5)-methyltransferase and p53 modulate expression of p53-repressed promoters.
15635413 2005 Nucleolar proteome dynamics.
15526354 2004 Expression of Dnmt1, demethylase, MeCP2 and methylation of tumor-related genes in human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375672 2004 Association analyses of DNA methyltransferase-1 (DNMT1) polymorphisms with systemic lupus erythematosus.
15340041 2004 Doxorubicin inhibits DNMT1, resulting in conditional apoptosis.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15289832 2004 Inhibition of DNA methyltransferase by antisense oligodeoxynucleotide modifies cell characteristics in gastric cancer cell lines.
15220328 2004 Human DNA methyltransferase 1 is required for maintenance of the histone H3 modification pattern.
15087453 2004 DNA methyltransferase 1 knock down induces gene expression by a mechanism independent of DNA methylation and histone deacetylation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14978102 2004 Physical and functional interactions between Daxx and DNA methyltransferase 1-associated protein, DMAP1.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14734556 2004 RGS6 interacts with DMAP1 and DNMT1 and inhibits DMAP1 transcriptional repressor activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684836 2004 DNA-methyltransferase 1 mRNA is selectively overexpressed in telencephalic GABAergic interneurons of schizophrenia brains.
14583449 2003 p53-mediated repression of DNA methyltransferase 1 expression by specific DNA binding.
14577574 2003 Transcriptional control of the DNA methyltransferases is altered in aging and neoplastically-transformed human fibroblasts.
14559786 2003 Double RNA interference of DNMT3b and DNMT1 enhances DNA demethylation and gene reactivation.
12915469 2003 Genetic unmasking of epigenetically silenced tumor suppressor genes in colon cancer cells deficient in DNA methyltransferases.
12804601 2003 Establishment and functional validation of a structural homology model for human DNA methyltransferase 1.
12789259 2003 pRb2/p130-E2F4/5-HDAC1-SUV39H1-p300 and pRb2/p130-E2F4/5-HDAC1-SUV39H1-DNMT1 multimolecular complexes mediate the transcription of estrogen receptor-alpha in breast cancer.
12738984 2003 Over-expression of DNA methyltransferases and CDKN2A gene methylation status in squamous cell carcinoma of the oral cavity.
12712445 2003 Increased protein expression of DNA methyltransferase (DNMT) 1 is significantly correlated with the malignant potential and poor prognosis of human hepatocellular carcinomas.
12711675 2003 The DNA methyltransferases associate with HP1 and the SUV39H1 histone methyltransferase.
12637155 2003 Mutation of the DNA methyltransferase (DNMT) 1 gene in human colorectal cancers.
12594811 2003 Decrease of DNA methyltransferase 1 expression relative to cell proliferation in transitional cell carcinoma.
12576480 2003 Epigenomic stress response. Knockdown of DNA methyltransferase 1 triggers an intra-S-phase arrest of DNA replication and induction of stress response genes.
12548018 DNMT1 is a component of a multiprotein DNA replication complex.
12538344 2003 Human DNA methyltransferase gene DNMT1 is regulated by the APC pathway.
12530095 DNMT1 gene copy number does not influence susceptibility to development of malignant lymphoproliferative disease.
12496760 2003 DNMT1 is required to maintain CpG methylation and aberrant gene silencing in human cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473678 2003 Methyl-CpG-binding protein, MeCP2, is a target molecule for maintenance DNA methyltransferase, Dnmt1.
12354094 2002 PCNA clamp facilitates action of DNA cytosine methyltransferase 1 on hemimethylated DNA.
12145218 2002 Co-operation and communication between the human maintenance and de novo DNA (cytosine-5) methyltransferases.
11940649 2002 DNA methyltransferase deficiency modifies cancer susceptibility in mice lacking DNA mismatch repair.
11932749 2002 DNMT1 and DNMT3b cooperate to silence genes in human cancer cells.
11847125 2002 The retinoblastoma gene product interacts with maintenance human DNA (cytosine-5) methyltransferase and modulates its activity.
11834837 2002 Methyltransferase recruitment and DNA hypermethylation of target promoters by an oncogenic transcription factor.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11728338 2001 A critical role for Dnmt1 and DNA methylation in T cell development, function, and survival.
11399088 2001 The activity of the murine DNA methyltransferase Dnmt1 is controlled by interaction of the catalytic domain with the N-terminal part of the enzyme leading to an allosteric activation of the enzyme after binding to methylated DNA.
11222358 2001 Expression of DNA methyltransferases DNMT1, 3A, and 3B in normal hematopoiesis and in acute and chronic myelogenous leukemia.
11005794 2000 The DNA methyltransferases of mammals.
10947852 2000 MBD2-MBD3 complex binds to hemi-methylated DNA and forms a complex containing DNMT1 at the replication foci in late S phase.
10888886 2000 DNMT1 forms a complex with Rb, E2F1 and HDAC1 and represses transcription from E2F-responsive promoters.
10888872 2000 DNMT1 binds HDAC2 and a new co-repressor, DMAP1, to form a complex at replication foci.
10801130 2000 CpG methylation is maintained in human cancer cells lacking DNMT1.
10753866 2000 Characterization of the human DNA methyltransferase splice variant Dnmt1b.
10721735 2000 Transcriptional regulation of the human DNA Methyltransferase (dnmt1) gene.
10615135 2000 DNA methyltransferase Dnmt1 associates with histone deacetylase activity.
10449766 1999 Two major forms of DNA (cytosine-5) methyltransferase in human somatic tissues.
10444590 1999 Loss of Daxx, a promiscuously interacting protein, results in extensive apoptosis in early mouse development.
10325416 1999 The human DNA methyltransferases (DNMTs) 1, 3a and 3b: coordinate mRNA expression in normal tissues and overexpression in tumors.
9449671 1998 Sex-specific exons control DNA methyltransferase in mammalian germ cells.
9333948 1997 Tying it all together: epigenetics, genetics, cell cycle, and cancer.
9302295 1997 Human DNA-(cytosine-5) methyltransferase-PCNA complex as a target for p21WAF1.
8940105 1996 New 5' regions of the murine and human genes for DNA (cytosine-5)-methyltransferase.
8917520 1996 Complementation of methylation deficiency in embryonic stem cells by a DNA methyltransferase minigene.
7760804 1995 E2F-5, a new E2F family member that interacts with p130 in vivo.
3210246 1988 Cloning and sequencing of a cDNA encoding DNA methyltransferase of mouse cells. The carboxyl-terminal domain of the mammalian enzymes is related to bacterial restriction methyltransferases.
2014266 1991 High expression of the DNA methyltransferase gene characterizes human neoplastic cells and progression stages of colon cancer.
1968655 1990 DNA methylation: evolution of a bacterial immune function into a regulator of gene expression and genome structure in higher eukaryotes.
1594447 1992 Isolation and characterization of the cDNA encoding human DNA methyltransferase.