Property Summary

NCBI Gene PubMed Count 11
PubMed Score 31.15
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer -1.537 1.6e-10
non primary Sjogren syndrome sicca 1.700 1.8e-02

Gene RIF (5)

PMID Text
23507146 HSF4 exerts its function on lens differentiation via positive regulation of DLAD expression.
21390259 These data identify DNase 2 as the predominant DNase on the mammalian skin surface and indicate that its activity is primarily targeted to exogenous DNA.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
11700027 gene lie head-to-head with the urate oxidase gene

AA Sequence

MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTT      1 - 70
RSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFW     71 - 140
LIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMP    141 - 210
QLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCS    211 - 280
LPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAF    281 - 350
QGLVLYYESCK                                                               351 - 361
//

Text Mined References (12)

PMID Year Title
23507146 2013 HSF4 regulates DLAD expression and promotes lens de-nucleation.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
21390259 2011 DNase 2 is the main DNA-degrading enzyme of the stratum corneum.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12944971 2003 Nuclear cataract caused by a lack of DNA degradation in the mouse eye lens.
12594037 2003 A family history of deoxyribonuclease II: surprises from Trichinella spiralis and Burkholderia pseudomallei.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11700027 2001 Isolation and characterization of the DLAD/Dlad genes, which lie head-to-head with the genes for urate oxidase.
11376952 2001 The cloning, genomic structure, localization, and expression of human deoxyribonuclease IIbeta.