Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.12
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
oligodendroglioma 2849 9.0e-03
Disease Target Count Z-score Confidence
Situs Inversus 52 4.267 2.1
Disease Target Count
Mirror movements 3 1

Expression

  Differential Expression (1)

Disease log2 FC p
oligodendroglioma -1.100 9.0e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (2)

PMID Text
25236653 No mutation in DNAL4 in Congenital mirror movements.
25098561 DNAL4 may play a role in the cytoplasmic dynein complex for netrin-1-directed retrograde transport, and in commissural neurons of the corpus callosum in particular. This could lead to faulty cross-brain wiring, resulting in Mirror movements (MRMV).

AA Sequence

MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH      1 - 70
VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS                                        71 - 105
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25236653 2014 Congenital mirror movements: no mutation in DNAL4 in 17 index cases.
25098561 2014 Identification of a homozygous splice site mutation in the dynein axonemal light chain 4 gene on 22q13.1 in a large consanguineous family from Pakistan with congenital mirror movement disorder.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15454493 2005 Identification of cooperative genes for NUP98-HOXA9 in myeloid leukemogenesis using a mouse model.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157096 2001 Association of Trk neurotrophin receptors with components of the cytoplasmic dynein motor.
10591208 1999 The DNA sequence of human chromosome 22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.