Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.98
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.000 3.9e-05
astrocytic glioma -1.500 1.2e-02
Astrocytoma, Pilocytic -1.300 1.5e-06
atypical teratoid / rhabdoid tumor -1.800 1.5e-08
chronic rhinosinusitis -1.086 2.3e-03
ependymoma -1.200 2.0e-05
glioblastoma -1.300 2.8e-06
group 3 medulloblastoma -1.300 2.9e-02
invasive ductal carcinoma -1.690 1.4e-04
medulloblastoma, large-cell -2.100 3.5e-05
osteosarcoma 1.028 6.6e-04
ovarian cancer -1.600 4.0e-09
Pick disease -1.200 7.6e-03

Gene RIF (2)

AA Sequence

MEANMPKRKEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIF      1 - 70
DMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTK     71 - 140
HRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSASFTKEQADAIR    141 - 210
RIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK           211 - 273
//

Text Mined References (15)

PMID Year Title