Property Summary

NCBI Gene PubMed Count 68
PubMed Score 100.93
PubTator Score 53.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.300 4.0e-02
esophageal adenocarcinoma -1.300 2.2e-02
glioblastoma 1.100 7.4e-03
osteosarcoma -2.096 3.5e-04
ovarian cancer 1.700 4.5e-04
pancreatic cancer 1.100 5.4e-04
pancreatic carcinoma 1.100 5.4e-04
tuberculosis and treatment for 3 months -1.400 6.7e-04

Protein-protein Interaction (2)

Gene RIF (41)

AA Sequence

MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK      1 - 70
EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF     71 - 140
FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE    141 - 210
NGQERVEVEEDGQLKSLTINGVADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEE    211 - 280
GEQDRPRAPGPWDPLASAAGLKEGGKRKKQKQREESKKKKSTKGNH                            281 - 326
//

Text Mined References (74)

PMID Year Title