Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGE      1 - 70
AGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTP     71 - 140
FLCLQ                                                                     141 - 145
//

Text Mined References (9)

PMID Year Title