Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.71
PubTator Score 4.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
CILIARY DYSKINESIA, PRIMARY, 34 1 0.0 0.0
Disease Target Count P-value
nasopharyngeal carcinoma 1024 5.2e-08
ovarian cancer 8297 1.7e-06
osteosarcoma 7766 9.3e-06
ependymoma 4559 3.2e-04
Disease Target Count Z-score Confidence
Cryptorchidism 287 4.31 2.2
Male infertility 199 3.063 1.5
Disease Target Count
Primary ciliary dyskinesia 75

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 3.2e-04
nasopharyngeal carcinoma -1.200 5.2e-08
osteosarcoma 1.180 9.3e-06
ovarian cancer 1.700 1.7e-06

Gene RIF (3)

AA Sequence

MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEE      1 - 70
GLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQV     71 - 140
ERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPAD    141 - 210
IIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPL    211 - 280
PEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT                                      281 - 316
//

Text Mined References (9)

PMID Year Title