Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.94
PubTator Score 21.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.6e-05
glioblastoma 5572 3.3e-04
osteosarcoma 7933 9.5e-04
ovarian cancer 8491 2.6e-03
Disease Target Count Z-score Confidence
Wegener's granulomatosis 14 3.913 2.0
Subacute bacterial endocarditis 3 3.66 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.700 3.6e-05
osteosarcoma -1.269 9.5e-04
glioblastoma -1.100 3.3e-04
ovarian cancer 1.400 2.6e-03

Gene RIF (6)

PMID Text
24318877 we combined the Hsp70-NEF pairs with cochaperones of the J protein family (DnaJA1, DnaJA2, DnaJB1, and DnaJB4) to generate 16 permutations.
23091061 The DNAJA2 substrate release mechanism is essential for chaperone-mediated folding.
19940115 Hsp40 type 1 chaperones DJA1 (DNAJA1/Hdj2) and DJA2 (DNAJA2) as key modulators of hERG degradation
18976975 Knockdown of DnaJ (Hsp40) homolog, subfamily A, member 2 (DNAJA2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18684711 Bag1 NEF increased refolding by Hsc70 and DJA2, as did the newly characterized NEF Hsp110
18595009 Rdj2 modulates G protein signaling and further suggest that chaperoning G proteins is an emerging theme of the J protein network.

AA Sequence

MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYG      1 - 70
EQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKN     71 - 140
VLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKV    141 - 210
IKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALC    211 - 280
GFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSE    281 - 350
LEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ            351 - 412
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23091061 2012 The DNAJA2 substrate release mechanism is essential for chaperone-mediated folding.
22085931 2012 Optimal functional levels of activation-induced deaminase specifically require the Hsp40 DnaJa1.
21269460 2011 Initial characterization of the human central proteome.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19940115 2010 Hsp40 chaperones promote degradation of the HERG potassium channel.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18684711 2008 Functional divergence between co-chaperones of Hsc70.
18595009 2009 RDJ2 (DNAJA2) chaperones neural G protein signaling pathways.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308774 2004 A tagging-via-substrate technology for detection and proteomics of farnesylated proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
10816573 2000 Human DnaJ homologs dj2 and dj3, and bag-1 are positive cochaperones of hsc70.
10651811 2000 The membrane-bound DnaJ protein located at the cytosolic site of glyoxysomes specifically binds the cytosolic isoform 1 of Hsp70 but not other Hsp70 species.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9710638 1998 Core histones and HIRIP3, a novel histone-binding protein, directly interact with WD repeat protein HIRA.
9383053 1997 Human CPR (cell cycle progression restoration) genes impart a Far- phenotype on yeast cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.