Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.90
PubTator Score 6.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (6)

PMID Text
23428944 These results suggest that dermokine-beta delays early cutaneous wound healing in part by inhibiting expression of CXC chemokines containing the ERL-sequence motif.
23060565 Serum DK is a potential biomarker in intraductal papillary mucinous neoplasm and invasive ductal carcinoma, when used in combination with conventional biomarkers.
22735594 Dermokine-beta impairs ERK signaling through direct binding to GRP78
21423773 Dmkndelta activates Rab5 function and thus is involved in the early endosomal trafficking.
17380110 Dermokine gene is expressed in epithelial tissues other than the skin and this expression is transcriptionally and posttranscriptionally complex.
16374476 Analysis of alternative spliced transcripts produced from the dermokine gene.

AA Sequence

MKFQGPLACLLLALCLGSGEAGPLQSGEESTGTNIGEALGHGLGDALSEGVGKAIGKEAGGAAGSKVSEA      1 - 70
LGQGTREAVGTGVRQVPGFGVADALGNRVGEAAHALGNTGHEIGRQAEDVIRHGADAVRGSWQGVPGHNG     71 - 140
AWETSGGHGIFGSQGGLGGQGQGNPGGLGTPWVHGYPGNSAGSFGMNPQGAPWGQGGNGGPPNFGTNTQG    141 - 210
AVAQPGYGSVRASNQNEGCTNPPPSGSGGGSSNSGGGSGSQSGSSGSGSNGDNNNGSSSGGSSSGSSSGG    211 - 280
SSGGSSGGSSGNSGGSRGDSGSESSWGSSTGSSSGNHGGSGGGNGHKPGCEKPGNEARGSGESGIQNSET    281 - 350
SPGMFNFDTFWKNFKSKLGFINWDAINKNQVPPPSTRALLYFSRLWEDFKQNTPFLNWKAIIEGADASSL    351 - 420
QKRAGRDDQNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASRVQPGLLQWVKFW                  421 - 476
//

Text Mined References (18)

PMID Year Title
23428944 2013 Dermokine inhibits ELR(+)CXC chemokine expression and delays early skin wound healing.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23060565 2012 Dermokine expression in intraductal papillary-mucinous neoplasm and invasive pancreatic carcinoma.
22735594 2012 Dermokine-? impairs ERK signaling through direct binding to GRP78.
21423773 2011 The ubiquitous dermokine delta activates Rab5 function in the early endocytic pathway.
17380110 2007 Dermokine: an extensively differentially spliced gene expressed in epithelial cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16374476 2006 The human dermokine gene: description of novel isoforms with different tissue-specific expression and subcellular location.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15234001 2004 Identification of novel keratinocyte-secreted peptides dermokine-alpha/-beta and a new stratified epithelium-secreted protein gene complex on human chromosome 19q13.1.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.