Property Summary

NCBI Gene PubMed Count 22
PubMed Score 42.26
PubTator Score 16.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -3.300 1.8e-03
Astrocytoma, Pilocytic -2.700 1.3e-03
atypical teratoid / rhabdoid tumor -2.200 3.9e-02
cystic fibrosis 2.118 3.2e-06
ependymoma -3.600 1.5e-03
glioblastoma -2.400 4.4e-02
group 4 medulloblastoma -2.900 1.3e-02
invasive ductal carcinoma 2.000 4.4e-02
oligodendroglioma -2.800 3.6e-03
osteosarcoma 1.887 1.8e-07

 GO Component (1)

Gene RIF (14)

AA Sequence

MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYP      1 - 70
YVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQL     71 - 140
QALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSP    141 - 210
PVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM                             211 - 255
//

Text Mined References (23)

PMID Year Title