Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.77
PubTator Score 23.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.900 5.7e-04
posterior fossa group A ependymoma -3.900 3.5e-11
oligodendroglioma -2.800 1.7e-03
glioblastoma -4.500 1.8e-06
medulloblastoma -3.900 2.5e-05
atypical teratoid / rhabdoid tumor -4.400 4.6e-08
medulloblastoma, large-cell -4.100 1.4e-03
primitive neuroectodermal tumor -3.800 1.2e-03
pediatric high grade glioma -3.300 4.0e-05
pilocytic astrocytoma -3.600 1.1e-05
Pick disease -1.400 3.9e-02
pituitary cancer -1.800 4.1e-03

Gene RIF (10)

PMID Text
25391383 The Gene-based analyses revealed four significant associations in the WT1, ZC3H12C, DLGAP2, and GPR1 genes at p < 0.05. in this study.
24416398 DLGAP2 is a susceptible gene of schizophrenia.
23154099 this study demonistrated that two SNPs in DLGAP2 (rs6558484 and rs7014992) and prefrontal cortex white matter volume.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20531469 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
18055845 DLGAP2 gene is imprinted, with preferential expression from the paternal allele in testis.
15030493 Increased expression of PSD-25 and its coassembly with NMDA-receptor subunits NR1 and MR2B in resected epileptic cortical tissue suggest a possible functional role of the complex in in situ epileptogenicity of focal cortical dysplasia.

AA Sequence

MGTAQVLPGILQKHCCILPDRNTESQCTLCGEPEEEEAGDLVQPGISFPGPAEEDLDPQYSWSPTQHFNE      1 - 70
ERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYLLSPADSCPGGRHRCSPRSSV     71 - 140
HSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHAGAKINRIPANLLDQFEKQLPLHRDGFHTLQ    141 - 210
YQRTSAAAEQRSESPGRIRHLVHSVQKLFTKSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSK    211 - 280
ERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKC    281 - 350
SACEGLALTPDAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQVPQDEWGGYPT    351 - 420
GGKDEEIPCRRMRSGSYIKAMGDEESGESDSSPKTSPKSAILPEPLLKSIGQRPLGEHQTQTYLQAASDV    421 - 490
PVGHSLDPAANYNSPKFRSRNQSYMRAVSTLSQASCVSQVSEAEINGQFESVCESVFSEVESQAMDALDL    491 - 560
PGCFRTRSHSYLRAIQAGYSQDDECIPMMTPSDITSTIRSTAAVSYTNYKKTPPPVPPRTTSKPLISVTA    561 - 630
QSSTESTQDAYQDSRAQRMSPWPQDSRGLYNSTDSLDSNKAMNLALETAAAQRHLPESQSSSVRTSDKAI    631 - 700
LVSKAEELLKSRCSSIGIQDSEFPEHQPYPRSDVETATDSDTESRGLREYHSVGVQVEDEKRHGRFKRSN    701 - 770
SVTAAVQADLELEGFPGHITTEDKGLQFGSSFQRHSEPSTPTQYSAVRTVRTQGLFSYREDYRTQVDTST    771 - 840
LPPPDPWLEPAIDTVETGRMSPCRRDGSWFLKLLHAETKRMEGWCKEMEREAEENDLSEEILGKIRSAVG    841 - 910
SAQLLMSQKFQQFYWLCQQNMDPSAMPRPTSQDLAGYWDMLQLSIEDVSMKFDELQRLRLNDWKMMESPE    911 - 980
RKEERKVPPPIPKKPPKGKFPITREKSLDLPDRQRQEARRRLMAAKRAASFRQNSASERADSIEIYIPEA    981 - 1050
QTRL                                                                     1051 - 1054
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25391383 2015 Genetic variation in imprinted genes is associated with risk of late-onset Alzheimer's disease.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24416398 2014 Role of the DLGAP2 gene encoding the SAP90/PSD-95-associated protein 2 in schizophrenia.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
23154099 2013 Glutamate system genes and brain volume alterations in pediatric obsessive-compulsive disorder: a preliminary study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20531469 2010 Functional impact of global rare copy number variation in autism spectrum disorders.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
18055845 2007 Computational and experimental identification of novel human imprinted genes.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15030493 2004 Increased numbers of coassembled PSD-95 to NMDA-receptor subunits NR2B and NR1 in human epileptic cortical dysplasia.
14508709 2003 Slowed conduction and thin myelination of peripheral nerves associated with mutant rho Guanine-nucleotide exchange factor 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10854099 2000 Positional cloning and characterisation of the human DLGAP2 gene and its exclusion in progressive epilepsy with mental retardation.
10759891 2000 Association of synapse-associated protein 90/ postsynaptic density-95-associated protein (SAPAP) with neurofilaments.
9314494 1997 High-resolution mapping and transcript identification at the progressive epilepsy with mental retardation locus on chromosome 8p.
9286858 1997 DAP-1, a novel protein that interacts with the guanylate kinase-like domains of hDLG and PSD-95.
9115257 1997 SAPAPs. A family of PSD-95/SAP90-associated proteins localized at postsynaptic density.