Property Summary

NCBI Gene PubMed Count 103
PubMed Score 149.14
PubTator Score 193.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
interstitial lung disease 2.600 5.7e-04
malignant mesothelioma -5.400 3.7e-09
astrocytic glioma -2.000 2.3e-03
posterior fossa group A ependymoma -3.100 3.7e-12
oligodendroglioma -1.500 5.7e-03
psoriasis 2.100 1.0e-03
osteosarcoma 3.881 1.2e-03
glioblastoma -2.300 4.4e-03
group 4 medulloblastoma -3.200 4.3e-05
atypical teratoid/rhabdoid tumor -3.000 1.5e-06
medulloblastoma, large-cell -3.300 2.4e-03
primitive neuroectodermal tumor -2.500 2.7e-02
adrenocortical carcinoma -1.198 2.6e-04
non-small cell lung cancer 1.257 2.0e-08
intraductal papillary-mucinous adenoma (... -2.400 5.2e-03
intraductal papillary-mucinous carcinoma... -2.800 2.4e-03
intraductal papillary-mucinous neoplasm ... -2.600 2.3e-02
lung cancer 4.200 6.4e-07
colon cancer 2.200 3.1e-03
pancreatic cancer 1.300 1.3e-03
fibroadenoma 3.500 2.3e-03
pediatric high grade glioma -2.300 3.2e-04
pilocytic astrocytoma -2.100 1.3e-03
acute myeloid leukemia 1.600 4.4e-02
lung adenocarcinoma 1.100 1.1e-05
lung carcinoma 5.200 3.9e-34
Pick disease -1.100 5.8e-03
pterygium 1.100 1.2e-02
ductal carcinoma in situ 1.200 4.4e-02
ulcerative colitis 1.400 4.1e-04

Gene RIF (109)

PMID Text
26588490 the reduction of SAT DIO2 expression is negatively correlated with DBP and TG levels that are associated with the MetS. This might have an effect on developing MetS.
26284425 conversion of T4 to T3 by D2 is required for TRalpha1/PI3K-mediated nongenomic actions of T4 in HUVECs, including stimulation of Akt phosphorylation and Rac activation, which result in cell migration.
26207529 In subjects who are alcohol dependent, the rs225014 DIO2 gene was associated with significant differences in the amount of naturalistic alcohol drinking.
26125736 DIO2 gene polymorphisms may play a role in the incidence of MCI in male patients.
26098717 DIO2 gene plays a role in the etiology of recurrent depressive disorder.Association of the DIO2 gene single nucleotide polymorphisms with recurrent depressive disorder.
25569702 Ala92-D2 accumulates in the Golgi, where its presence and/or ensuing oxidative stress disrupts basic cellular functions and increases pre-apoptosis.
25306702 Molecular genetic markers of predisposition to the development of thyroid disease are: GG genotype and allele G gene DIO2 (274A > G), CT and CC genotypes of the gene CYP1A1 (-3798T > C), associated with the development of nodular goiter
25304215 Thyroid hormone deiodinases D1, D2, and D3 are differentially expressed in endothelial cells following thyroid hormone exposure.
25140401 Identification of two heterozygous nonsynonymous mutations in the thyroid hormone activating type 2 deiodinase.
25105294 The rs225017 polymorphism in the 3'UTR of the human DIO2 gene is associated with increased insulin resistance.
24878678 [review] D2 variants correlate with thyroid hormone levels, insulin resistance, bipolar mood disorder, psychological well-being, mental retardation, hypertension, and risk for osteoarthritis.
24695009 Data provide evidence in humans that genetic predisposition combined with early osteoarthritis-related changes results in loff of epigenetic silencing of DIO2.
24480136 Mutations affecting DIO2 are not a common cause of high BMD in healthy euthyroid post-menopausal women.
24355051 Type 2 deiodinase (DIO2) Thr92Ala polymorphism is associated with reduced placental DIO2 activity but not with dysglycemia, increased insulin resistance, or worse gestational outcomes.
24196352 interaction between UbD2 and p97/Atx3 mediates retranslocation of UbD2 to the cytoplasm for terminal degradation in the proteasomes.
24058403 Single Nucleotide Polymorphisms in the genes GPX1 (rs1050450, rs1800668 and rs3811699), TrxR2 (rs5748469), and DIO2 (rs225014) may not be significantly associated with Kashin-Beck disease in a Tibetan population.
23719846 Data suggest posttranslational mechanism via proteasomal degradation (not NFkappaB [nuclear factor-kappa-B] activation) is involved in suppression of DIO2 (type 2 iodothyronine deiodinase) by TNFalpha (tumor necrosis factor-alpha) in thyroid cells.
23329579 DIO2 rs7140952 polymorphism is associated with components of metabolic syndrome including blood pressure and central obesity in hypothyroid patients.
23296253 findings demonstrate that upregulated expression of DIO2 in osteoarthritis (OA) patient cartilage might be responsible for OA pathogenesis by enhancing the chondrocyte hypertrophy and inflammatory response.
23193417 An association of type 2 deiodinase Thr92Ala polymorphism with frequency of disease development.
23013882 genetic association study in population of women in Italy: Data suggest that an SNP in DIO2 (T92A) is not associated with autoimmune thyroiditis in the population studied.
22689263 Data show that C/EBPalpha and C/EBPbeta promote Dio2 expression in the trophoblastic cell line JEG3 through a conserved CCAAT element, which is a novel key component of the Dio2 promoter code that confers tissue-specific expression of D2 in these cells.
22492780 In osteoarthritis cartilage, D2 protein presence is increased.
22353746 DIO2 modifies inflammatory responses in chondrocytes.
22307573 Common polymorphisms in DIO2 subtly affect the circulating levels of thyroid hormone and modulate thyroid hormone homeostasis.
22259052 Data suggest that DIO2 expression is increased in dorsocervical subcutaneous brown adipose tissue among patients with HIV lipodystrophy, particularly those with increased visceral adiposity, and is positively associated with energy expenditure.
22207295 investigation of DIO1 and DIO2 activities in 66 thyroid tissue samples from follicular thyroid adenoma, toxic diffuse goiter, nontoxic multinodular goiter, papillary thyroid carcinoma, and surrounding normal tissues
22142372 Variation in DIO2 may have a subtle role in altering metabolic processes that lead to early-onset NIDDM, but this gene does not have a large impact on NIDDM at older ages, nor does DIO2 influence BMI in the Pima Indian population.
22053000 deiodinase iodothyronine type II is selectively lost during endoplasmic reticulum stress due to an eukaryotic initiation factor 2-mediated decrease in synthesis and sustained proteasomal degradation
22048657 The DIO2 gene was genotyped by using five haplotype-tagging single-nucleotide polymorphisms (SNPs) in 157 Chinese mental retardation high-density family pedigrees, including 452 nuclear families and >1460 persons.
21715540 Our data suggest that the negative feedback of free T4 on TSH is weaker in patients homozygous for the D2-rs12885300 T allele than in wild-type and heterozygous subjects.
21685153 DIO2 is a novel ALI candidate gene, the nonsynonymous Thr92Ala coding variant of which confers ALI protection. Increased DIO2 expression
21323585 D2 activity and mRNA are present in the human preadipocytes from both mesenteric and subcutaneous adipose tissue.
21292729 [REVIEW] discuss the molecular mechanisms by which DIO2 controls intracellular T(3) availability and action
21054208 The commonly occurring Thr92Ala D2 variant is associated with a decreased rate of acute TSH-stimulated T3 release from the thyroid consistent with a decrease in intrathyroidal deiodination.
21054208 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20930717 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20566590 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373986 Thigh subcutaneous adipose tissue from subjects with familial partial lipodystrophy 2 has higher DIO2 expression of & activity than abdominal SAT, suggesting that changes in local thyroid hormone metabolism may occur in areas with lipoatrophy.
20200941 The D2 Thr92Ala polymorphism is associated with a decreased femoral neck bone mineral density and higher bone turnover.
20200941 Observational study of gene-disease association. (HuGE Navigator)
20178852 Observational study of gene-disease association. (HuGE Navigator)
20176747 hDIO2 promoter is down-regulated at the transcriptional level by both LXR and RXR signal pathway.
19684474 Data show that Thr92Ala Type 2 polymorphism in Type 2 deiodinase is protectively decreasing thyrotoxicosis severity, relapse probability and heart pathologic changes intensity.
19684474 Observational study of gene-disease association. (HuGE Navigator)
19651899 TEB4 interacts with and mediates loss of type 2 iodothyronine deiodinase (D2)activity, indicating that D2 ubiquitination and degradation can be tissue specific, depending on WSB-1 and TEB4 expression levels.
19427350 Genetic variations of type II deiodinase are associated with bipolar disorder in a subset of a Chinese Han population.
19427350 Observational study of gene-disease association. (HuGE Navigator)
19293265 Human skeletal muscle D2 mRNA expression is modulated by fasting and insulin, but not by hypothyroidism.
19190113 commonly inherited variation in the DIO2 gene is associated both with impaired baseline psychological well-being on thryoxine and enhanced response to combination triiodothyronine therapy
19190113 Observational study of gene-disease association. (HuGE Navigator)
19178511 The D2-Thr92Ala, D2-ORFa-Gly3Asp and TSHR-Asp727Glu polymorphisms were not associated with blood pressure or the risk of hypertension.
19178511 Observational study of gene-disease association. (HuGE Navigator)
19018782 The D2-Thr92Ala polymorphism is not associated with blood thyroid hormone levels.
19018782 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18514391 D2 is highly expressed in human medullary thyroid carcinoma
18492748 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18349068 The role of type 1 and type 2 5'-deiodinase in the pathophysiology of the 3,5,3'-triiodothyronine toxicosis of McCune-Albright syndrome.
18334578 Results indicate a new susceptibility gene (DIO2) conferring risk to osteoarthritis.
18334578 Observational study of gene-disease association. (HuGE Navigator)
18285610 Observational study of gene-disease association. (HuGE Navigator)
18198294 There is a combined effect of DIO2 T92A and PPARgamma2 P12A polymorphisms on insulin resistance-related features in non-diabetic whites.
18198294 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18073314 D2 Thr92Ala polymorphism seems to predict the need for higher T4 intake in thyroidectomized patients.
18073314 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17991726 EGF modulates transcription of human type II deiodinase gene (Dio2) through distinct signaling pathways, leading to the assembly of a heterogeneous transcription factor complex
17504898 reduced D2 activity does not play a role in the pathogenesis of the low triiodothyronine syndrome of critical illness
17452445 Ubiquitination can also regulate proteins by transiently inactivating enzymatic function through conformational change in a dimeric enzyme, which can be reversed upon deubiquitination.
17408423 Observational study of gene-disease association. (HuGE Navigator)
17389255 Observational study of gene-disease association. (HuGE Navigator)
17381351 Observational study of gene-disease association. (HuGE Navigator)
17381351 there is no association of the DIO2 A/G polymorphism with diabetes intermediate trait levels or DM2 risk
17244789 Increased thyroidal D2 activity in the thyroid gland is responsible for the higher serum-free levels in patients with defective thyroglobin transport.
17224473 Observational study of gene-disease association. (HuGE Navigator)
17224473 The Ala92 allele of the type 2 iodothyronine deiodinase increases risk for the development of hypertension.
17105838 Observational study of gene-disease association. (HuGE Navigator)
17105838 DIO2 variants were not associated with serum thyroid parameters in the elderly
17077128 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16928685 the instability loop in D2, but not its subcellular localization, is the key determinant of D2 susceptibility to ubiquitination and rapid turnover rate
16889485 analysis of a human type-2 deiodinase polymorphism
16728541 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16728495 results indicate that inflammatory signals regulate iodothyronine deiodinase type II expression predominantly via the nuclear factor-kappa B pathway in a direct transcriptional manner
16356084 Observational study of gene-disease association. (HuGE Navigator)
16144953 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16140305 D2 expression is increased by BPS and suppressed by PDGF in hCASMCs, and that intracellular thyroid hormone activation may be involved in the suppression of DNA synthesis and migration activity of hCASMCs.
16131328 analysis of the pretranslational regulation of D2 [review]
16127464 Results suggest that impairment of type 2 iodothyronine deiodinase-generated triiodothyronine (T3) is the major cause of the reduced T3 production in the euthyroid sick syndrome.
15797963 Observational study of gene-disease association. (HuGE Navigator)
15797963 Single nucleotide polymorphism is associated with greater insulin resistance in type 2 diabetes mellitus patients and with lower D2 velocity in tissue samples.
15785240 DIO1 and DIO2 were underexpressed in nearly all papillary thyroid carcinomas
15727947 Observational study of gene-disease association. (HuGE Navigator)
15727947 We hypothesize that this might be explained by the decline in skeletal muscle size during aging, resulting in a relative decrease in the contribution of D2 to serum T(3) production.
15291742 characterisation of the CRE/TATA box unit of type 2 deiodinase gene promoter in a human choriocarcinoma cell line
15286152 Observational study of gene-disease association. (HuGE Navigator)
15286152 Variation in the DIO2 gene may affect the availability Triiodothyronine and a iodine deficiency that may partly determin and overall risk of mental retardation in china.
15240580 Iodothyronine deiodinases D2 and D3 play important roles in local bioavailability of triiodothyronine T(3). T(3) is produced from thyroxine T(4) by D2, and D3 protects brain regions from excessive T(3) until differentiation is required.
12933904 In endoplasmic reticulum, degradation proceeds via an association with UBC7.
12847093 D2 contains a glycoside hydrolase clan GH-A-like structure
12775767 Nkx-2.5 and GATA-4 play prime roles in Dio2 gene regulation in the human heart and suggests that it is their synergistic action in humans that causes the differential expression of the cardiac Dio2 gene between humans and rats.
12699588 transcription factor Pax-8 could be involved in the upregulation of DIO2 expression in the thyroid of Graves' patients
12586771 overexpressed iodothyronine deiodinase types 1,2, and 3 can homodimerize probably through disulfide bridges and types 1 and 2 monomeric forms are catalytically active
12198238 Ubc6p and Ubc7p are required for normal and substrate-induced ubiquitination and proteolysis of D2
12153750 finding that normal pituitary tissue and pituitary adenomas expressed 5'-deiodinase activity implies that both enzymes are active in tumors and local deiodination is important for function and feedback regulation of anterior pituitary
12089359 The inhibition by D2 5'UTR is localized to a region of the first short open reading frame encoding a tripeptide-MKG
11897672 mutants with a cysteine or serine two-residue amino terminal to the SeC are enzymatically active and displayed similar Michaelis-Menten constant values for T(4) and reverse T(3) as the wild-type D2 enzyme
11872697 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11716958 The effects of TNF-alpha, interleukin-6 and interferon gamma were studied on the activity of type 2,5'-deiodinase and on the binding of [125I] T(4) to proteins in human thyroid cytosolic (supernatant) and membrane (pellet) fractions
11716036 Type 2 iodothyronine deiodinase expression is upregulated by the protein kinase A-dependent pathway and is downregulated by the protein kinase C-dependent pathway in cultured human thyroid cells.

AA Sequence

MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLD      1 - 70
AYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSATUPPFTSQL     71 - 140
PAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRV    141 - 210
VADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG           211 - 273
//

Text Mined References (105)

PMID Year Title
26588490 2016 Subcutaneous Adipose Tissue Type II Deiodinase Gene Expression Reduced in Obese Individuals with Metabolic Syndrome.
26284425 2015 Type 2 Iodothyronine Deiodinase Activity Is Required for Rapid Stimulation of PI3K by Thyroxine in Human Umbilical Vein Endothelial Cells.
26207529 2015 Effect of Functionally Significant Deiodinase Single Nucleotide Polymorphisms on Drinking Behavior in Alcohol Dependence: An Exploratory Investigation.
26125736 2015 Type II deiodinase polymorphisms and serum thyroid hormone levels in patients with mild cognitive impairment.
26098717 2015 Association of the DIO2 gene single nucleotide polymorphisms with recurrent depressive disorder.
25569702 2015 Prevalent polymorphism in thyroid hormone-activating enzyme leaves a genetic fingerprint that underlies associated clinical syndromes.
25306702 [DIO2, TPO, CYP1A1 AND CYP1A2 gene polymorphism in women with thyroid disease].
25304215 2015 Thyroid hormone deiodinases D1, D2, and D3 are expressed in human endothelial dermal microvascular line: effects of thyroid hormones.
25140401 2014 Functional analysis of novel genetic variation in the thyroid hormone activating type 2 deiodinase.
25105294 2014 The rs225017 polymorphism in the 3'UTR of the human DIO2 gene is associated with increased insulin resistance.
24878678 2014 Genetics in endocrinology: genetic variation in deiodinases: a systematic review of potential clinical effects in humans.
24695009 2015 Underlying molecular mechanisms of DIO2 susceptibility in symptomatic osteoarthritis.
24480136 2014 THRA and DIO2 mutations are unlikely to be a common cause of increased bone mineral density in euthyroid post-menopausal women.
24355051 2014 Type 2 deiodinase Thr92Ala polymorphism is associated with disrupted placental activity but not with dysglycemia or adverse gestational outcomes: a genetic association study.
24196352 2013 The type II deiodinase is retrotranslocated to the cytoplasm and proteasomes via p97/Atx3 complex.
24058403 2013 Association study of polymorphisms in selenoprotein genes and Kashin-Beck disease and serum selenium/iodine concentration in a Tibetan population.
23719846 2013 A novel mechanism for the inhibition of type 2 iodothyronine deiodinase by tumor necrosis factor ?: involvement of proteasomal degradation.
23329579 2013 The role of type II deiodinase polymorphisms in clinical management of hypothyroid patients treated with levothyroxine.
23296253 2013 Deiodinase 2 upregulation demonstrated in osteoarthritis patients cartilage causes cartilage destruction in tissue-specific transgenic rats.
23193417 2012 Thr92Ala polymorphism of human type 2 deiodinase gene (hD2) affects the development of Graves' disease, treatment efficiency, and rate of remission.
23013882 2013 Prevalence of Dio2(T92A) polymorphism and its association with thyroid autoimmunity.
22689263 2012 CCAAT/enhancer-binding proteins are key regulators of human type two deiodinase expression in a placenta cell line.
22492780 2012 Increased type II deiodinase protein in OA-affected cartilage and allelic imbalance of OA risk polymorphism rs225014 at DIO2 in human OA joint tissues.
22353746 2012 DIO2 modifies inflammatory responses in chondrocytes.
22307573 2012 The -258A/G (SNP rs12885300) polymorphism of the human type 2 deiodinase gene is associated with a shift in the pattern of secretion of thyroid hormones following a TRH-induced acute rise in TSH.
22259052 2012 Deiodinase 2 expression is increased in dorsocervical fat of patients with HIV-associated lipohypertrophy syndrome.
22207295 2012 Positive correlation between type 1 and 2 iodothyronine deiodinases activities in human goiters.
22142372 2012 Association analyses of variants in the DIO2 gene with early-onset type 2 diabetes mellitus in Pima Indians.
22053000 2011 Endoplasmic reticulum stress decreases intracellular thyroid hormone activation via an eIF2a-mediated decrease in type 2 deiodinase synthesis.
22048657 2012 A family-based association study of DIO2 and children mental retardation in the Qinba region of China.
21715540 2011 The type 2 deiodinase ORFa-Gly3Asp polymorphism (rs12885300) influences the set point of the hypothalamus-pituitary-thyroid axis in patients treated for differentiated thyroid carcinoma.
21685153 2011 Type 2 deiodinase and host responses of sepsis and acute lung injury.
21323585 2011 Type 2 iodothyronine deiodinase is expressed in human preadipocytes.
21292729 2011 Deiodinases: the balance of thyroid hormone: local control of thyroid hormone action: role of type 2 deiodinase.
21054208 2010 The Thr92Ala 5' type 2 deiodinase gene polymorphism is associated with a delayed triiodothyronine secretion in response to the thyrotropin-releasing hormone-stimulation test: a pharmacogenomic study.
20930717 2011 D2 Thr92Ala and PPAR?2 Pro12Ala polymorphisms interact in the modulation of insulin resistance in type 2 diabetic patients.
20566590 2010 Association of the type 2 deiodinase Thr92Ala polymorphism with type 2 diabetes: case-control study and meta-analysis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20373986 2010 Regional decrease of subcutaneous adipose tissue in patients with type 2 familial partial lipodystrophy is associated with changes in thyroid hormone metabolism.
20200941 2010 The type 2 deiodinase Thr92Ala polymorphism is associated with increased bone turnover and decreased femoral neck bone mineral density.
20178852 2010 Association study between polymorphisms in selenoprotein genes and susceptibility to Kashin-Beck disease.
20176747 2010 Regulation of thyroid hormone activation via the liver X-receptor/retinoid X-receptor pathway.
19684474 2009 Type 2 deiodinase Thr92Ala polymorphism impact on clinical course and myocardial remodeling in patients with Graves' disease.
19651899 2009 The E3 ubiquitin ligase TEB4 mediates degradation of type 2 iodothyronine deiodinase.
19427350 2009 Association of genetic polymorphisms in the type II deiodinase gene with bipolar disorder in a subset of Chinese population.
19293265 2009 Type 2 iodothyronine deiodinase in skeletal muscle: effects of hypothyroidism and fasting.
19190113 2009 Common variation in the DIO2 gene predicts baseline psychological well-being and response to combination thyroxine plus triiodothyronine therapy in hypothyroid patients.
19178511 2009 Impact of thyroid function and polymorphisms in the type 2 deiodinase on blood pressure: the Rotterdam Study and the Rotterdam Scan Study.
19018782 2009 Thr92Ala polymorphism in the type 2 deiodinase is not associated with T4 dose in athyroid patients or patients with Hashimoto thyroiditis.
18514391 2008 Type 2 iodothyronine deiodinase is highly expressed in medullary thyroid carcinoma.
18492748 2008 A common variation in deiodinase 1 gene DIO1 is associated with the relative levels of free thyroxine and triiodothyronine.
18349068 2008 The role of type 1 and type 2 5'-deiodinase in the pathophysiology of the 3,5,3'-triiodothyronine toxicosis of McCune-Albright syndrome.
18334578 2008 Identification of DIO2 as a new susceptibility locus for symptomatic osteoarthritis.
18285610 2008 Lack of association between the type 2 deiodinase A/G polymorphism and hypertensive traits: the Framingham Heart Study.
18198294 2007 Interaction of DIO2 T92A and PPARgamma2 P12A polymorphisms in the modulation of metabolic syndrome.
18073314 2008 Type 2 deiodinase polymorphism (threonine 92 alanine) predicts L-thyroxine dose to achieve target thyrotropin levels in thyroidectomized patients.
17991726 2008 Activation of thyroid hormone is transcriptionally regulated by epidermal growth factor in human placenta-derived JEG3 cells.
17504898 2007 The type II iodothyronine deiodinase is up-regulated in skeletal muscle during prolonged critical illness.
17452445 2007 Ubiquitination-induced conformational change within the deiodinase dimer is a switch regulating enzyme activity.
17408423 2007 The Asp727Glu polymorphism in the TSH receptor is associated with insulin resistance in healthy elderly men.
17389255 2007 Type 2 deiodinase Thr92Ala polymorphism is not associated with arterial hypertension in type 2 diabetes mellitus patients.
17381351 2007 The type 2 deiodinase (DIO2) A/G polymorphism is not associated with glycemic traits: the Framingham Heart Study.
17244789 2007 Thyroglobulin gene mutations producing defective intracellular transport of thyroglobulin are associated with increased thyroidal type 2 iodothyronine deiodinase activity.
17224473 2007 Ala92 type 2 deiodinase allele increases risk for the development of hypertension.
17105838 2007 The association of polymorphisms in the type 1 and 2 deiodinase genes with circulating thyroid hormone parameters and atrophy of the medial temporal lobe.
17077128 2007 Studies of the common DIO2 Thr92Ala polymorphism and metabolic phenotypes in 7342 Danish white subjects.
16928685 2006 Metabolic instability of type 2 deiodinase is transferable to stable proteins independently of subcellular localization.
16889485 2006 Functional characterization of the 258 A/G (D2-ORFa-Gly3Asp) human type-2 deiodinase polymorphism: a naturally occurring variant increases the enzymatic activity by removing a putative repressor site in the 5' UTR of the gene.
16728541 2006 Thyrotropin, but not a polymorphism in type II deiodinase, predicts response to paroxetine in major depression.
16728495 2006 Characterization of the nuclear factor-kappa B responsiveness of the human dio2 gene.
16356084 2005 The Thr92Ala deiodinase type 2 (DIO2) variant is not associated with type 2 diabetes or indices of insulin resistance in the old order of Amish.
16144953 2005 Polymorphisms in type 2 deiodinase are not associated with well-being, neurocognitive functioning, and preference for combined thyroxine/3,5,3'-triiodothyronine therapy.
16140305 2006 Regulation of iodothyronine deiodinase and roles of thyroid hormones in human coronary artery smooth muscle cells.
16131328 2005 Pretranslational regulation of type 2 deiodinase.
16127464 2005 Type 2 iodothyronine deiodinase is the major source of plasma T3 in euthyroid humans.
15797963 2005 The type 2 deiodinase A/G (Thr92Ala) polymorphism is associated with decreased enzyme velocity and increased insulin resistance in patients with type 2 diabetes mellitus.
15785240 2005 Gene expression profiles reveal that DCN, DIO1, and DIO2 are underexpressed in benign and malignant thyroid tumors.
15727947 2005 A new polymorphism in the type II deiodinase gene is associated with circulating thyroid hormone parameters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15291742 2004 Functional characterisation of the CRE/TATA box unit of type 2 deiodinase gene promoter in a human choriocarcinoma cell line.
15286152 2004 Positive association of the DIO2 (deiodinase type 2) gene with mental retardation in the iodine-deficient areas of China.
15240580 2004 Iodothyronine levels in the human developing brain: major regulatory roles of iodothyronine deiodinases in different areas.
12933904 2003 Endoplasmic reticulum-associated degradation of the human type 2 iodothyronine deiodinase (D2) is mediated via an association between mammalian UBC7 and the carboxyl region of D2.
12865408 2003 Deubiquitination of type 2 iodothyronine deiodinase by von Hippel-Lindau protein-interacting deubiquitinating enzymes regulates thyroid hormone activation.
12847093 2003 The iodothyronine selenodeiodinases are thioredoxin-fold family proteins containing a glycoside hydrolase clan GH-A-like structure.
12775767 2003 The different cardiac expression of the type 2 iodothyronine deiodinase gene between human and rat is related to the differential response of the Dio2 genes to Nkx-2.5 and GATA-4 transcription factors.
12699588 2003 Pax-8 expression correlates with type II 5' deiodinase expression in thyroids from patients with Graves' disease.
12586771 2003 In vivo dimerization of types 1, 2, and 3 iodothyronine selenodeiodinases.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198238 2002 Ubc6p and ubc7p are required for normal and substrate-induced endoplasmic reticulum-associated degradation of the human selenoprotein type 2 iodothyronine monodeiodinase.
12153750 2002 Expression of 5'-deiodinase enzymes in normal pituitaries and in various human pituitary adenomas.
12089359 2002 The mRNA structure has potent regulatory effects on type 2 iodothyronine deiodinase expression.
11872697 2002 Association between a novel variant of the human type 2 deiodinase gene Thr92Ala and insulin resistance: evidence of interaction with the Trp64Arg variant of the beta-3-adrenergic receptor.
11165050 2001 Identification of two novel splicing variants of human type II iodothyronine deiodinase mRNA.
11089566 2000 Distinct subcellular localization of transiently expressed types 1 and 2 iodothyronine deiodinases as determined by immunofluorescence confocal microscopy.
10614643 2000 Characterization of the 5'-flanking and 5'-untranslated regions of the cyclic adenosine 3',5'-monophosphate-responsive human type 2 iodothyronine deiodinase gene.
10343107 1999 Assignment of type II iodothyronine deiodinase gene (DIO2) to human chromosome band 14q24.2-->q24.3 by in situ hybridization.
9837913 1998 The 3'-untranslated region of human type 2 iodothyronine deiodinase mRNA contains a functional selenocysteine insertion sequence element.
9723885 1998 Genomic characterization of the coding region of the human type II 5'-deiodinase gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
8770868 1996 Type 2 iodothyronine deiodinase is highly expressed in human thyroid.
8755651 1996 Cloning of the mammalian type II iodothyronine deiodinase. A selenoprotein differentially expressed and regulated in human and rat brain and other tissues.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
1400883 1992 Cloning and in vitro expression of the human selenoprotein, type I iodothyronine deiodinase.