Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.07
PubTator Score 0.26

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


AA Sequence

LAAWKKNPKYLLAEYCEWLPQAMHPDIEKAWPPTTVH                                    1121 - 1157

Text Mined References (5)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.