Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.33
PubTator Score 1.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 5.3e-06
chronic rhinosinusitis -1.453 2.7e-02
ependymoma 1.100 5.9e-04
glioblastoma 1.600 2.7e-04
group 3 medulloblastoma 1.400 3.8e-05
malignant mesothelioma 1.600 1.1e-07
medulloblastoma, large-cell 2.300 1.1e-06
osteosarcoma 1.592 1.3e-06
pediatric high grade glioma 1.100 1.7e-03
primitive neuroectodermal tumor 1.100 1.2e-04

Gene RIF (2)

AA Sequence

MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQRQKLPVFKLRNHILYLIENY      1 - 70
QTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDD     71 - 140
CTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASAT    141 - 210
LDADKFRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVVKIHQTEGDGDVLAF    211 - 280
LTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPSFEQMKVFERVSRSVRKVIVATNVAETSIT    281 - 350
ISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDKLPQSTVP    351 - 420
EMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNP    421 - 490
MFAKMLLESGNFGCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHRKFAVEEGDHLTMLNIYEAFIKHNK    491 - 560
DSKWCQEHFLNYKGLVRAATVREQLKKLLVKFQVPRKSSEGDPDLVLRCIVSGFFANAARFHSTGAYRTI    561 - 630
RDDHELHIHPASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQQGTHLSLKAKRAKV    631 - 700
QDP                                                                       701 - 703
//

Text Mined References (11)

PMID Year Title