Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.49
PubTator Score 2.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.9e-07
ependymoma 1.100 1.1e-10
glioblastoma 1.200 3.3e-08
group 3 medulloblastoma 1.100 1.7e-03
ovarian cancer 1.100 2.8e-04
pancreatic ductal adenocarcinoma liver m... -1.580 1.9e-03
pediatric high grade glioma 1.300 9.3e-08
primitive neuroectodermal tumor 1.100 5.4e-05

Gene RIF (1)

AA Sequence

MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV      1 - 70
IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT     71 - 140
RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ    141 - 210
SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA    211 - 280
AVTPELEGVGGHYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL                        281 - 330
//

Text Mined References (10)

PMID Year Title