Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.90
PubTator Score 28.24

Knowledge Summary

Patent (587)

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.385 1.6e-03
pancreatic cancer 1.200 7.2e-03

Gene RIF (22)

PMID Text
26887948 DGKeta-Pleckstrin Homology Domain preferentially interacts with Phosphatidylinositol 4,5-Bisphosphate and has crucial roles in regulating the subcellular localization and physiological function of DGKeta.
25081328 These findings implicate a link between nucleotide variant of DGKH and a cause for a complex-trait disease, calcium oxalate stone
24958494 This study demonstrated that significant association of the DGKH risk haplotype with increased amygdala volume in Bipolar disorder, but not in schizophreia or healthy controls.
23177175 DGKK variants are associated with hypospadias
22048461 Differential effects of DGKH in healthy controls vs the bipolar high-risk group manifest as a failure to disengage default-mode regions in those at familial risk carrying the risk haplotype.
21654738 Four DGKH markers are linked to adult attention-hyperactivity disorder and seven to unipolar depression, making DGKH a risk factor gene for bipolar disorder, unipolar depression and adult attention-deficit hyperactivity disorder.
21548979 expressions of DGKeta and DGKzeta were increased and decreased, respectively, whereas those of DGKgamma and DGKepsilon remained unchanged. This is the first report that describes the differential regulation of DGK isoforms in normal and failing human hearts.
21507135 Although the association was not strong, the result of this study would support the association between DGKH and BD.
20733578 The results of tisd support DGKH as shared risk factor of bipolar disorder and schizophrenia in the Chinese Han population.
20733578 Observational study of gene-disease association. (HuGE Navigator)
20519059 Increased gene expression of diacylglycerol kinase eta is found in brain tissue from patients with bipolar disorder.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19818381 While negative, our findings do not exclude an involvement of DGKH and NR1D1 in lithium prophylaxis.
19818381 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19710016 DGKeta acts as a novel critical regulatory component of the Ras/B-Raf/C-Raf/MEK/ERK signaling cascade via a previously unidentified mechanism.
19478689 No significant association after multiple-testing correction between any of the single nucleotide polymorphisms in DGKH and bipolar disorder, was found.
19478689 Observational study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
19308021 Observational study of gene-disease association. (HuGE Navigator)
17486107 diacylglycerol kinase eta (DGKH) is association in the etiology of bipolar disorder.
17486107 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12810723 alternative splicing of the human DGK eta gene generates at least two isoforms with distinct biochemical and cell biological properties responding to different cellular metabolic requirements

AA Sequence

MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQIRTKTSIKEG      1 - 70
QLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNANNSFTIITPFRRLMLCA     71 - 140
ENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCK    141 - 210
FKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCL    211 - 280
WCKTMVHTACKDLYHPICPLGQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFL    281 - 350
RRFKQLLNPAQVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG    351 - 420
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEASEEFYMTIYED    421 - 490
SVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVADAVASKCSVLNEKLEQLLQA    491 - 560
LHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLGDDVTKPSSQKAVKPREIMLRANSLKKAVRQ    561 - 630
VIEEAGKVMDDPTVHPCEPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSV    631 - 700
PGPAVAASKENLPVLNTRIICPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCV    701 - 770
MNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP    771 - 840
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQHHRIAQCRTVK    841 - 910
ITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKCDSGKPVLRTHLYIHH    911 - 980
AIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVNACSHALNKANPRCPESLTRDTATEI    981 - 1050
AINVKALYNETESLLVGRVPLQLESPHEERVSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKR   1051 - 1120
NNRSTVFRIVPKFKKEKVQKQKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDL   1121 - 1190
KDLGIPKVGHVKRILQGIKELGRSTPQSEV                                           1191 - 1220
//

Text Mined References (31)

PMID Year Title
26887948 2016 The Pleckstrin Homology Domain of Diacylglycerol Kinase ? Strongly and Selectively Binds to Phosphatidylinositol 4,5-Bisphosphate.
25221879 2014 Genome-wide interrogation of longitudinal FEV1 in children with asthma.
25081328 2014 Association study of DGKH gene polymorphisms with calcium oxalate stone in Chinese population.
24958494 2015 Influence of DGKH variants on amygdala volume in patients with bipolar affective disorder and schizophrenia.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23177175 2013 Diacylglycerol kinase K variants impact hypospadias in a California study population.
22396660 2012 A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.
22048461 2012 Effect of variation in diacylglycerol kinase ? (DGKH) gene on brain function in a cohort at familial risk of bipolar disorder.
21654738 2011 Cross-disorder analysis of bipolar risk genes: further evidence of DGKH as a risk gene for bipolar disorder, but also unipolar depression and adult ADHD.
21548979 2011 Differential regulation of diacylglycerol kinase isoform in human failing hearts.
21507135 2011 Nominal association between a polymorphism in DGKH and bipolar disorder detected in a meta-analysis of East Asian case-control samples.
20733578 2011 Common SNPs and haplotypes in DGKH are associated with bipolar disorder and schizophrenia in the Chinese Han population.
20519059 2010 Increased gene expression of diacylglycerol kinase ? in bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19818381 2009 Interacting genes in lithium prophylaxis: preliminary results of an exploratory analysis on the role of DGKH and NR1D1 gene polymorphisms in 199 Sardinian bipolar patients.
19710016 2009 Diacylglycerol kinase eta augments C-Raf activity and B-Raf/C-Raf heterodimerization.
19478689 2009 No association between DGKH and bipolar disorder in a Scandinavian case-control sample.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17486107 2008 A genome-wide association study implicates diacylglycerol kinase eta (DGKH) and several other genes in the etiology of bipolar disorder.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810723 2003 Identification and characterization of two splice variants of human diacylglycerol kinase eta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9438377 1997 Molecules in focus: diacylglycerol kinase.
8702685 1996 Cloning and characterization of a glucocorticoid-induced diacylglycerol kinase.