Property Summary

NCBI Gene PubMed Count 48
PubMed Score 60.38
PubTator Score 74.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.128 5.4e-03
psoriasis -1.400 3.2e-04
glioblastoma 1.300 3.6e-03
juvenile dermatomyositis 1.125 3.0e-11
pancreatic ductal adenocarcinoma liver m... -1.337 1.2e-03
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 9.1e-04
Breast cancer 3.100 2.5e-02
ovarian cancer 2.200 1.6e-05

Protein-protein Interaction (12)

Gene RIF (21)

PMID Text
26173415 Results showed that Derlin-1 is overexpressed in colon cancer and promotes proliferation of colon cancer cells.
25030448 TMEM129 contains an unusual cysteine-only RING with intrinsic E3 ligase activity and is recruited to US11 via Derlin-1.
24089527 Cav-1 may be a cofactor in the interaction of Derlin-1 and N-glycosylated COX-2 and may facilitate Derlin-1- and p97 complex-mediated COX-2 ubiquitination, retrotranslocation, and degradation.
23306155 Derlin-1 is overexpressed in non-small cell lung cancer and promotes invasion by EGFR-ERK-mediated up-regulation of MMP-2 and MMP-9.
22627700 Upregulation of derlin-1 may be associated with endoplasmic reticulum stress in neuronal cells in Alzheimer's disease.
22311976 Derlin-1 expression levels may affect glucose-stimulated insulin secretion by altering surface expression of K(ATP) channels.
22238364 These results indicate that ApoB after lipidation is dislocated from the ER lumen to the LD surface for proteasomal degradation and that Derlin-1 and UBXD8 are engaged in the predislocation and postdislocation steps, respectively.
21184741 Derlin-1 is a negative regulator for both glycosylated and non-glycosylated BCRP expression and provide a novel posttranslational regulatory mechanism of BCRP by Derlin-1.
19114714 Derlin-1 did not modify KCNQ1 expression level, and no interaction between endogenous KCNQ1 and Derlin-1 could be detected.
18927294 Overexpression of DERL1 is associated with neoplasms
18227067 KCa3.1 and KCa2.3 are translocated out of the endoplasmic reticulum associated with Derlin-1.
18205950 derlin-1 overexpression in breast cancer, together with its function in relieving ER stress-induced apoptosis, suggests that regulation of the ER stress response pathway may be critical in the development and progression of breast cancer.
18094046 These findings indicate that Derlin-1 facilitates the retro-translocation of Cholera toxin.
18048502 DERL1-containing protein mediates the endoplasmic reticulum-associated degradation of V2 vasopressin receptors.
17872946 SVIP is an endogenous inhibitor of ERAD that acts through regulating the assembly of the gp78-p97/VCP-Derlin1 complex.
17453418 The pool of active Derlin-1 in the ER membrane can be modulated in response to ER stress.
16954204 Derlin-1 recognizes misfolded, nonubiquitylated CFTR to initiate its dislocation and degradation early in the course of CFTR biogenesis, perhaps by detecting structural instability within the first transmembrane domain
16186510 Derlin-1 is part of a retrotranslocation channel that is associated with both the polyubiquitination and p97-ATPase machineries at the endoplasmic reticulum membrane.
16055502 Derlin-1 interacts with the N-terminal domain of PNGase via its cytosolic C-terminus. PNGase distributed in two populations; ER-associated and free in the cytosol, which suggests the deglycosylation process can proceed at either site
15215856 Derlin-1 interacts with US11, a virally encoded ER protein that specifically targets MHC class I heavy chains for export from the ER, as well as with VIMP, a novel membrane protein that recruits the p97 ATPase and its cofactor
15215855 Derlin-1 is an important factor for the extraction of certain aberrantly folded proteins from the mammalian ER

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGF      1 - 70
LYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDM     71 - 140
IVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWL    141 - 210
PSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ                                 211 - 251
//

Text Mined References (55)

PMID Year Title
26173415 2015 Derlin-1 is overexpressed in human colon cancer and promotes cancer cell proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
25416956 2014 A proteome-scale map of the human interactome network.
25239945 2014 Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.
25030448 2014 TMEM129 is a Derlin-1 associated ERAD E3 ligase essential for virus-induced degradation of MHC-I.
24089527 2013 Caveolin-1 interacts with Derlin-1 and promotes ubiquitination and degradation of cyclooxygenase-2 via collaboration with p97 complex.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23306155 2013 Derlin-1 is overexpressed in non-small cell lung cancer and promotes cancer cell invasion via EGFR-ERK-mediated up-regulation of MMP-2 and MMP-9.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22627700 2012 Derlin-1-immunopositive inclusions in patients with Alzheimer's disease.
22311976 2012 Role of Derlin-1 protein in proteostasis regulation of ATP-sensitive potassium channels.
22238364 2012 Derlin-1 and UBXD8 are engaged in dislocation and degradation of lipidated ApoB-100 at lipid droplets.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21909096 2011 Derlin-1 is a rhomboid pseudoprotease required for the dislocation of mutant ?-1 antitrypsin from the endoplasmic reticulum.
21269460 2011 Initial characterization of the human central proteome.
21185345 2011 Derlin-1 overexpression ameliorates mutant SOD1-induced endoplasmic reticulum stress by reducing mutant SOD1 accumulation.
21184741 2011 Posttranslational negative regulation of glycosylated and non-glycosylated BCRP expression by Derlin-1.
19946888 2010 Defining the membrane proteome of NK cells.
19818707 2009 The otubain YOD1 is a deubiquitinating enzyme that associates with p97 to facilitate protein dislocation from the ER.
19135427 2009 USP14 inhibits ER-associated degradation via interaction with IRE1alpha.
19114714 2009 LQT1-associated mutations increase KCNQ1 proteasomal degradation independently of Derlin-1.
18927294 2008 Derlin-1 is overexpressed on the tumor cell surface and enables antibody-mediated tumor targeting therapy.
18675248 2008 Ubiquitin ligase Kf-1 is involved in the endoplasmic reticulum-associated degradation pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18555783 2008 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex.
18227067 2008 Role of S3 and S4 transmembrane domain charged amino acids in channel biogenesis and gating of KCa2.3 and KCa3.1.
18205950 2008 Derlin-1 is overexpressed in human breast carcinoma and protects cancer cells from endoplasmic reticulum stress-induced apoptosis.
18094046 2008 Derlin-1 facilitates the retro-translocation of cholera toxin.
18048502 2008 Derlin-1 and p97/valosin-containing protein mediate the endoplasmic reticulum-associated degradation of human V2 vasopressin receptors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17872946 2007 Identification of SVIP as an endogenous inhibitor of endoplasmic reticulum-associated degradation.
17453418 The oligomeric state of Derlin-1 is modulated by endoplasmic reticulum stress.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17000876 2006 Regulation of retrotranslocation by p97-associated deubiquitinating enzyme ataxin-3.
16954204 2006 Derlin-1 promotes the efficient degradation of the cystic fibrosis transmembrane conductance regulator (CFTR) and CFTR folding mutants.
16901789 2006 Sequential quality-control checkpoints triage misfolded cystic fibrosis transmembrane conductance regulator.
16449189 2006 Derlin-2 and Derlin-3 are regulated by the mammalian unfolded protein response and are required for ER-associated degradation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289116 2005 The ubiquitin-domain protein HERP forms a complex with components of the endoplasmic reticulum associated degradation pathway.
16186510 2005 Recruitment of the p97 ATPase and ubiquitin ligases to the site of retrotranslocation at the endoplasmic reticulum membrane.
16186509 2005 Multiprotein complexes that link dislocation, ubiquitination, and extraction of misfolded proteins from the endoplasmic reticulum membrane.
16055502 2005 The retrotranslocation protein Derlin-1 binds peptide:N-glycanase to the endoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15215856 2004 A membrane protein complex mediates retro-translocation from the ER lumen into the cytosol.
15215855 2004 A membrane protein required for dislocation of misfolded proteins from the ER.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.