Property Summary

NCBI Gene PubMed Count 11
PubMed Score 154.97
PubTator Score 40.04

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.060 4.4e-02
astrocytoma 1.500 8.9e-24
dermatomyositis 1.900 8.1e-04
glioblastoma 1.600 5.8e-04
Multiple myeloma 1.197 7.1e-03
oligodendroglioma 1.300 1.3e-14
ovarian cancer 2.000 4.1e-03
pediatric high grade glioma 1.200 1.3e-04
Pilocytic astrocytoma 1.100 1.5e-04
sonic hedgehog group medulloblastoma 1.400 8.0e-05
tuberculosis 1.300 8.3e-09

Gene RIF (1)

AA Sequence

LKPELFRIGASTLLSDIERQIYHHVTGRYAAYHDLPMS                                    281 - 318

Text Mined References (14)

PMID Year Title