Property Summary

NCBI Gene PubMed Count 30
PubMed Score 15488.74
PubTator Score 507.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.526 1.2e-03
malignant mesothelioma -7.600 9.5e-10
astrocytoma 1.100 3.9e-03
tuberculosis 1.400 3.0e-06
pancreatic ductal adenocarcinoma liver m... -1.106 2.1e-02
posterior fossa group B ependymoma 1.100 1.4e-10
subependymal giant cell astrocytoma 1.657 3.2e-02
ovarian cancer -1.900 2.6e-06

Gene RIF (11)

PMID Text
24326071 Our study is the first to demonstrate the novel function of UA in NET formation and may provide insight into the management of patients with hyperuricemia.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19049547 The TT genotype of C677T polymorphism in the MTHFR gene contributes to genetic susceptibility of acute ischemic stroke in a Singapore population.
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18472006 The luminal NADPH pool is an important antiapoptotic factor in neutrophil granulocytes.
18193341 mutational defects cause chronic granulomatous disease in humans
15629123 Sequence alignment indicates that there are five highly conserved acidic residues, one of which (E276) might act as a proton donor.
15531764 Structure and reactivity of human mitochondrial 2,4-dienoyl-CoA reductase

AA Sequence

MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTG      1 - 70
LGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNI     71 - 140
VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPS    141 - 210
ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANL    211 - 280
AAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS                   281 - 335
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24847004 2014 Mitochondrial NADP(H) deficiency due to a mutation in NADK2 causes dienoyl-CoA reductase deficiency with hyperlysinemia.
24326071 2014 Uric acid induces NADPH oxidase-independent neutrophil extracellular trap formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19049547 2008 Association of acute ischemic stroke with the MTHFR C677T polymorphism but not with NOS3 gene polymorphisms in a Singapore population.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18568448 2008 Calbindin 1, fibroblast growth factor 20, and alpha-synuclein in sporadic Parkinson's disease.
18472006 2008 Maintenance of luminal NADPH in the endoplasmic reticulum promotes the survival of human neutrophil granulocytes.
18193341 2008 Inflammatory manifestations in chronic granulomatous disease (CGD).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15629123 2005 Studies of human mitochondrial 2,4-dienoyl-CoA reductase.
15531764 2005 Structure and reactivity of human mitochondrial 2,4-dienoyl-CoA reductase: enzyme-ligand interactions in a distinctive short-chain reductase active site.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397064 2003 Metabolic functions of the two pathways of oleate beta-oxidation double bond metabolism during the beta-oxidation of oleic acid in rat heart mitochondria.
11591162 2001 The mechanism of dienoyl-CoA reduction by 2,4-dienoyl-CoA reductase is stepwise: observation of a dienolate intermediate.
10497069 1999 Cloning, expression, and purification of the functional 2,4-dienoyl-CoA reductase from rat liver mitochondria.
10318788 1999 Delta3,5,7,Delta2,4,6-trienoyl-CoA isomerase, a novel enzyme that functions in the beta-oxidation of polyunsaturated fatty acids with conjugated double bonds.
9403065 1997 Molecular cloning and characterization of the human mitochondrial 2,4-dienoyl-CoA reductase gene (DECR).
8993540 1996 Peroxisomal beta-oxidation and polyunsaturated fatty acids.
8300563 1994 Delta 3,5, delta 2,4-dienoyl-CoA isomerase from rat liver mitochondria. Purification and characterization of a new enzyme involved in the beta-oxidation of unsaturated fatty acids.
7818482 1994 Isolation and characterization of cDNA for human 120 kDa mitochondrial 2,4-dienoyl-coenzyme A reductase.
7263650 1981 Degradation of unsaturated fatty acids in peroxisomes. Existence of a 2,4-dienoyl-CoA reductase pathway.
1859445 1991 Effect of sorbic acid feeding on peroxisomes and sorboyl-CoA metabolizing enzymes in mouse liver. Selective induction of 2,4-dienoyl-CoA hydratase.
1495956 1992 NADPH-dependent beta-oxidation of unsaturated fatty acids with double bonds extending from odd-numbered carbon atoms.