Property Summary

NCBI Gene PubMed Count 30
PubMed Score 15488.74
PubTator Score 507.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q16698 B7Z6B8 Q2M304 Q93085
Symbols DECR
NADPH
SDR18C1

Gene

PANTHER Protein Class (2)

PDB

1W6U   1W73   1W8D  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
C. elegans OMA Inparanoid

Gene RIF (11)

PMID Text
24326071 Our study is the first to demonstrate the novel function of UA in NET formation and may provide insight into the management of patients with hyperuricemia.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19049547 The TT genotype of C677T polymorphism in the MTHFR gene contributes to genetic susceptibility of acute ischemic stroke in a Singapore population.
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18472006 The luminal NADPH pool is an important antiapoptotic factor in neutrophil granulocytes.
18193341 mutational defects cause chronic granulomatous disease in humans
15629123 Sequence alignment indicates that there are five highly conserved acidic residues, one of which (E276) might act as a proton donor.
More...

AA Sequence

MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTG      1 - 70
LGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNI     71 - 140
VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPS    141 - 210
ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANL    211 - 280
AAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS                   281 - 335
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24847004 2014 Mitochondrial NADP(H) deficiency due to a mutation in NADK2 causes dienoyl-CoA reductase deficiency with hyperlysinemia.
24326071 2014 Uric acid induces NADPH oxidase-independent neutrophil extracellular trap formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...