Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.48
PubTator Score 3.63

Knowledge Summary


No data available


  Disease (4)

Disease Target Count P-value
Amyotrophic lateral sclerosis 437 2.3e-07
ovarian cancer 8297 4.9e-07
non primary Sjogren syndrome sicca 861 2.1e-02
spina bifida 1053 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Colorectal adenocarcinoma 5 3.037 1.5


  Differential Expression (4)

Disease log2 FC p
Amyotrophic lateral sclerosis -1.173 2.3e-07
non primary Sjogren syndrome sicca 1.200 2.1e-02
ovarian cancer -1.200 4.9e-07
spina bifida 1.171 4.1e-02

Gene RIF (7)

AA Sequence

FLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM                                 841 - 881

Text Mined References (23)

PMID Year Title