Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.71
PubTator Score 1.66

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 103 0.0 0.0
Disease Target Count
malignant mesothelioma 3135
Disease Target Count P-value
medulloblastoma, large-cell 6086 6.1e-04


  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 6.1e-04

AA Sequence

RHELSSKLLQPLVPRYEEALSQLEESVKEERKQRAA                                      631 - 666

Text Mined References (21)

PMID Year Title