Property Summary

NCBI Gene PubMed Count 100
PubMed Score 200.49
PubTator Score 122.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
interstitial lung disease -1.300 4.1e-02
Multiple myeloma 1.842 2.7e-04
astrocytic glioma 1.100 3.3e-02
ependymoma 1.800 5.0e-03
oligodendroglioma 1.700 3.4e-03
psoriasis 1.500 1.3e-04
osteosarcoma 2.005 9.8e-04
atypical teratoid / rhabdoid tumor 1.200 7.3e-04
group 4 medulloblastoma 1.500 7.9e-04
medulloblastoma, large-cell 1.500 1.3e-04
hereditary spastic paraplegia -1.098 1.9e-02
lung cancer -1.400 8.7e-04
lung adenocarcinoma 1.194 4.5e-05
COPD -1.100 4.2e-03
progressive supranuclear palsy -1.200 5.6e-03
ovarian cancer -2.000 2.7e-05
Gaucher disease type 1 -2.000 1.2e-02
dermatomyositis -1.100 7.9e-03

Gene RIF (90)

PMID Text
27012366 Our results suggest that the intrinsically disordered N-terminal domain of DDX3 regulates its functions in translation by acting prior to the recruitment of the 43S pre-initiation complex onto the viral 5'-UTR.
26598523 analysis of the structural and functional core of the DDX3 subfamily of DEAD-box proteins
26454002 The DDX3 may participate in antiviral innate immunity, at least in part, by translational control of interferon-induced protein kinase (PACT).
26337079 Data show that knockdown of RNA helicase DDX3 in breast cancer MCF-7 and MDA-MB-231 cells resulted in decreased proliferation rates.
26311743 Data show that high cytoplasmic DEAD-box helicase 3 (DDX3) expression correlated with nuclear beta-catenin expression, a marker of activated Wnt signaling.
26290144 The results do not support our hypothesis that common germline genetic variants in the DDX3X genes is associated with the risk of developing medulloblastoma.
26235985 Mutations in DDX3X are a common cause of unexplained intellectual disability with gender-specific effects on Wnt signaling.
26192917 T-cell lymphoma patients with DDX3X mutations presented a poor prognosis.
26174373 As such, DDX3 has been shown to play roles both upstream and downstream of I-kappa beta kinase epsilon (IKKepsilon)/TANK-binding kinase 1, leading to IFN-beta production.
26087195 Data show that DEAD-box helicase 3 (DDX3) had a significant prognostic predictive power in colorectal cancer at both RNA and protein level.
25918862 Taken together, our result demonstrates that Ketorolac salt is a newly discovered bioactive compound against DDX3 and this compound can be used as an ideal drug candidate to treat DDX3 associated oral cancer.
25820276 Loss of DDX3 function either by shRNA or by RK-33 impaired Wnt signaling through disruption of the DDX3-beta-catenin axis and inhibited non-homologous end joining-the major DNA repair pathway in mammalian somatic cells.
25740981 Upon infection, the HCV 3'UTR redistributes DDX3X and IKK-alpha to speckle-like cytoplasmic structures shown to be stress granules.
25724843 Cancer-associated mutants of RNA helicase DDX3X are defective in RNA-stimulated ATP hydrolysis.
25723178 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
25631074 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
25538732 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
25496916 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
25437271 DDX3X, a member of DEAD-box RNA helicase, is necessary for IFN production and could inhibit DENV replication
25382417 identification of DDX3X mutations in 10% of cases, preferentially in males (4/5 cases); analysis suggested an association between DDX3X inactivation and clinically unfavorable features and poor outcome of chronic lymphocytic leukaemia
25377784 Mutations in DDX3X gene is associated with recurrent convergent evolution in chronic lymphocytic leukemia.
25343452 Either ligand-independent or ligand-induced EGFR phosphorylation was inhibited in lung cancer cells that strongly expressed DDX3X.
25231298 Overall, these results demonstrate that DDX3 represents an intrinsic host antiviral factor that restricts hepatitis B virus transcription.
25208899 Data suggest complex translational control mechanism(s) for the human DDX3X gene locus functioning only in the male germ line and resulting in expression of its protein only in the postmeiotic spermatids.
25188302 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
25043297 The DDX3-Rac1-beta-catenin regulatory axis in modulating the expression of Wnt/beta-catenin target genes.
25039764 This review discusses the considerable body of work on the biochemistry and biology of DDX3, including the recently discovered link of human DDX3 to tumorigenesis.
24418539 Host DDX3 regulates Japanese encephalitis virus replication by interacting with viral un-translated regions.
24330569 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
24183723 DDX3 seems to interact with the HIV-1 Tat and facilitate the Tat function.
24183723 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
23974721 These results suggest that anti-DDX3X immunotherapy is a promising treatment option in efforts to eradicate CSC in the clinical setting.
23840900 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
23754689 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
23673860 In pediatric T-acute lymphoblastic leukemia, we have identified 2 RNA processing genes, that is, HNRNPH1/5q35 and DDX3X/Xp11.3 as new MLLT10 fusion partners.
23608157 Results suggest that distinct DDX DEAD-box RNA helicases DDX3 and DDX5 cooperate to modulate the HIV-1 Rev function.
23608157 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
23584477 DDX3 loss by p53 inactivation via MDM2/Slug/E-cadherin pathway promotes tumor malignancy and poor patient outcome
23527197 DDX3 is a new key molecule to understand the molecular mechanism underlying RNAi pathway in mammals.
23478265 DDX3 is a scaffolding adaptor that directly facilitates phosphorylation of IRF3 by IKK-epsilon.
23413191 study identified DDX3 as a regulator of the Wnt-beta-catenin network, where it acts as a regulatory subunit of CK1epsilon: in a Wnt-dependent manner, DDX3 binds CK1epsilon and directly stimulates its kinase activity and promotes phosphorylation of the scaffold protein dishevelled
23410059 Low/negative DDX3 expression in tumor cells was significantly associated with aggressive clinical manifestations and might be an independent survival predictor, particularly in non-smoker patients with OSCC
23330003 Positive Nectin-2 and DDx3 expression is closely correlated with clinical, pathological, and biological behaviors as well as poor-prognosis of gallbladder cancer.
23125841 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
22872150 DEAD-box protein DDX3 associates with eIF4F to promote translation of selected mRNAs
22492871 miR-98 and miR-181a through their regulatory functions on PGRMC1, PGR, CYP19A1, TIMP3, and DDX3X expression may influence a wide range of endometrial cellular activities during normal menstrual cycle and transition into disease states.
22270009 Human Dead-box protein 3 (DDX3X), a RNA helicase regulating RNA splicing, export, transcription and translation was down-regulated upon MAT1A expression.
22174317 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
21883093 The present study has characterized DDX3 as a pivotal SG-nucleating factor and illustrates co-ordinative roles for DDX3, eIF4E and PABP1 in integrating environmental stress with translational regulation.
21730191 DEAD-box RNA helicase DDX3 and the RNA interference pathway promote mitotic chromosome segregation.
21698775 DDX3X knockdown does not affect cell growth (HeLaP4-CCR5 cells, partial knockdown (25% of normal levels)) but significantly impairs HIV-1 replication; HIV-1 replication is enhanced by DDX3X
21589879 results identify a specific domain of DDX3 which may be suited as target for antiviral drugs designed to inhibit cellular cofactors for HIV-1 replication
21448281 The role of DDX3 as a hypoxia-inducible gene that exhibits enhanced expression through the interaction of hypoxia inducible factor-1 with hypoxia inducible factor-1 responsive elements in its promoter region, is reported.
21428961 The role of DDX3 in antiviral immunity and its inhibition or exploitation by different viruses.
21360055 HIV-1 Rev cofactors Sam68, eIF5A, hRIP, and DDX3 function in the translation of HIV-1 RNA; the regulatory mechanisms of HIV-1 RNA translation are likely different among these cofactors.
21360055 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
21358275 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
21237216 Knockdown of DDX3 levels by shRNA reduced basal levels of Snail in HeLa and MCF-7 cells, and this was associated with reduced cell proliferation and migration.
21170385 Hepatitis C virus core protein abrogates the DDX3 function that enhances IPS-1-mediated IFN-beta induction
20862261 Replication of HCV is significantly suppressed in cells expressing green fluorescent protein fusions to HCV core protein residues 16-36.
20837705 Results indicate that DDX3 is critical for translation of cyclin E1 mRNA, which provides an alternative mechanism for regulating cyclin E1 expression during the cell cycle.
20657822 HBV Pol inhibits TBK1/IKKepsilon activity by disrupting the interaction between IKKepsilon and DDX3 DEAD box RNA helicase, explaining how HBV evades innate immune response in the early phase of the infection
20127681 DDX3 can bind viral RNA to join it in the IPS-1 complex to up-regulate IFN-beta promoter activation. The 622-662 a.a DDX3 C-terminal region directly bound to the IPS-1 CARD-like domain. The whole DDX3 protein associated with RIG-I-like receptors.
20018238 DDX3X knockdown does not affect cell growth (HeLaP4-CCR5 cells, partial knockdown (25% of normal levels)) but significantly impairs HIV-1 replication; HIV-1 replication is enhanced by DDX3X
19793905 This study shows for the first time that the requirement of DDX3 for hepatitis C virus replication is unrelated to its interaction with the viral core protein.
19782656 This review summarizes the data involving at least four different viruses (hepatitis C virus, hepatitis B virus, human immunodeficiency virus and poxviruses) that encode proteins that interact with DDX3 and manipulate its function.
19149558 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
18976975 DDX3X knockdown does not affect cell growth (HeLaP4-CCR5 cells, partial knockdown (25% of normal levels)) but significantly impairs HIV-1 replication; HIV-1 replication is enhanced by DDX3X
18845156 studies have mapped the K7-binding region to a 30-residue N-terminal fragment of DDX3, ahead of the core RNA helicase domains
18636090 DEAD box helicase is involved in TBK1/IKKepsilon-mediated IRF activation and Ifnb promoter induction.
18628297 Using RNA interference, DDX3 is shown to be required for expression of protein from reporter constructs.
18596238 DDX3 facilitates translation by resolving secondary structures of the 5'-untranslated region in mRNAs during ribosome scanning
18583960 DDX3X is a critical effector of TBK1 that is necessary for type I IFN induction.
18508616 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
18264132 the activation of DDX3 by BPDE can promote growth, proliferation and neoplastic transformation of breast epithelial cells
18259889 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
18187620 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
18187620 DDX3X knockdown does not affect cell growth (HeLaP4-CCR5 cells, partial knockdown (25% of normal levels)) but significantly impairs HIV-1 replication; HIV-1 replication is enhanced by DDX3X
17855521 DDX3 is required for hepatitis C virus RNA replication
17667941 study demonstrates regulatory roles and action mechanisms for DDX3 in translation, cell growth and likely viral replication
17661632 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
17631897 DDX3X is stabilized by AMP.
17357160 can be used for rational design of selective inhibitors of hDDX3
16818630 DDX3 suppresses tumor growth and transcriptionally activates the p21 promoter, and is inactivated through down-regulation of gene expression or alteration of subcellular localization in tumor cells; DDX3 might be a candidate tumor suppressor.
16354571 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
16301996 suggest that the deregulation of DDX3, a DEAD box RNA helicase with cell growth-regulatory functions, is involved in HBV- and HCV-associated pathogenesis
15588285 DEAD box proteins and other RNA-binding proteins may play roles in active HIV replication and in the control of viral latency.
15516266 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
15507209 Computational molecular docking, alanine scanning, clustering, and evolutionary analysis reveal the interaction of DDX3 with HIV-1 Rev-CRM1-RanGTP complex
11710523 Gene structure of the human DDX3 and chromosome mapping of its related sequences.Its organization was the same as that of the human DBY gene, a closely related sequence present on the Y chromosome.

AA Sequence

MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS      1 - 70
SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL     71 - 140
PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA    141 - 210
IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV    211 - 280
QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD    281 - 350
RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV    351 - 420
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG    421 - 490
KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL    491 - 560
VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS    561 - 630
SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN                                          631 - 662
//

Text Mined References (120)

PMID Year Title
27012366 2016 DEAD-box RNA helicase DDX3 connects CRM1-dependent nuclear export and translation of the HIV-1 unspliced mRNA through its N-terminal domain.
26598523 2016 Autoinhibitory Interdomain Interactions and Subfamily-specific Extensions Redefine the Catalytic Core of the Human DEAD-box Protein DDX3.
26454002 2016 DDX3 functions in antiviral innate immunity through translational control of PACT.
26337079 2015 NZ51, a ring-expanded nucleoside analog, inhibits motility and viability of breast cancer cells by targeting the RNA helicase DDX3.
26311743 2015 Identification of the DEAD box RNA helicase DDX3 as a therapeutic target in colorectal cancer.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26235985 2015 Mutations in DDX3X Are a Common Cause of Unexplained Intellectual Disability with Gender-Specific Effects on Wnt Signaling.
26192917 2015 Exome sequencing identifies somatic mutations of DDX3X in natural killer/T-cell lymphoma.
26174373 2015 RNA helicase DDX3: at the crossroad of viral replication and antiviral immunity.
26087195 2015 DDX3 as a strongest prognosis marker and its downregulation promotes metastasis in colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918862 2015 Ketorolac salt is a newly discovered DDX3 inhibitor to treat oral cancer.
25820276 2015 Targeting DDX3 with a small molecule inhibitor for lung cancer therapy.
25740981 2015 Dynamic Interaction of Stress Granules, DDX3X, and IKK-? Mediates Multiple Functions in Hepatitis C Virus Infection.
25724843 2015 Cancer-associated mutants of RNA helicase DDX3X are defective in RNA-stimulated ATP hydrolysis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25437271 2015 DEAD-box RNA helicase DDX3X inhibits DENV replication via regulating type one interferon pathway.
25382417 2015 Identification of recurrent truncated DDX3X mutations in chronic lymphocytic leukaemia.
25377784 2015 Deep sequencing identifies genetic heterogeneity and recurrent convergent evolution in chronic lymphocytic leukemia.
25343452 2014 DDX3X induces primary EGFR-TKI resistance based on intratumor heterogeneity in lung cancer cells harboring EGFR-activating mutations.
25231298 2014 DDX3 DEAD-box RNA helicase is a host factor that restricts hepatitis B virus replication at the transcriptional level.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25208899 2014 DDX3X, the X homologue of AZFa gene DDX3Y, expresses a complex pattern of transcript variants only in the male germ line.
25043297 2015 DDX3 modulates cell adhesion and motility and cancer cell metastasis via Rac1-mediated signaling pathway.
25039764 The Ded1/DDX3 subfamily of DEAD-box RNA helicases.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24855944 2014 The TRPM7 chanzyme is cleaved to release a chromatin-modifying kinase.
24584351 2014 DDX3X-MLLT10 fusion in adults with NOTCH1 positive T-cell acute lymphoblastic leukemia.
24418539 2014 Cellular DDX3 regulates Japanese encephalitis virus replication by interacting with viral un-translated regions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24183723 2013 DDX3 RNA helicase is required for HIV-1 Tat function.
24169621 2014 Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23974721 2013 DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked is an immunogenic target of cancer stem cells.
23840900 2013 Human DDX3 interacts with the HIV-1 Tat protein to facilitate viral mRNA translation.
23673860 2013 New MLLT10 gene recombinations in pediatric T-acute lymphoblastic leukemia.
23608157 2013 Distinct DDX DEAD-box RNA helicases cooperate to modulate the HIV-1 Rev function.
23606618 The role of the DEAD-box RNA helicase DDX3 in mRNA metabolism.
23584477 2014 DDX3 loss by p53 inactivation promotes tumor malignancy via the MDM2/Slug/E-cadherin pathway and poor patient outcome in non-small-cell lung cancer.
23527197 2013 Determination of the role of DDX3 a factor involved in mammalian RNAi pathway using an shRNA-expression library.
23478265 2013 Human DEAD box helicase 3 couples I?B kinase ? to interferon regulatory factor 3 activation.
23413191 2013 RNA helicase DDX3 is a regulatory subunit of casein kinase 1 in Wnt-?-catenin signaling.
23410059 2014 Low/negative expression of DDX3 might predict poor prognosis in non-smoker patients with oral cancer.
23330003 2013 Nectin-2 and DDX3 are biomarkers for metastasis and poor prognosis of squamous cell/adenosquamous carcinomas and adenocarcinoma of gallbladder.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22872150 2012 DEAD-box protein DDX3 associates with eIF4F to promote translation of selected mRNAs.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22616990 2012 Modulation of the type I interferon pathways by culture-adaptive hepatitis C virus core mutants.
22492871 2012 Endometrial miR-181a and miR-98 expression is altered during transition from normal into cancerous state and target PGR, PGRMC1, CYP19A1, DDX3X, and TIMP3.
22323517 2012 The DEAD-box helicase DDX3 supports the assembly of functional 80S ribosomes.
22270009 2012 Proteomic analysis of human hepatoma cells expressing methionine adenosyltransferase I/III: Characterization of DDX3X as a target of S-adenosylmethionine.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22034099 2012 The DEAD-box RNA helicase DDX3 interacts with DDX5, co-localizes with it in the cytoplasm during the G2/M phase of the cycle, and affects its shuttling during mRNP export.
21883093 2012 Critical roles of RNA helicase DDX3 and its interactions with eIF4E/PABP1 in stress granule assembly and stress response.
21730191 2011 DEAD-box RNA helicase Belle/DDX3 and the RNA interference pathway promote mitotic chromosome segregation.
21589879 2011 A motif unique to the human DEAD-box protein DDX3 is important for nucleic acid binding, ATP hydrolysis, RNA/DNA unwinding and HIV-1 replication.
21448281 2011 Expression of DDX3 is directly modulated by hypoxia inducible factor-1 alpha in breast epithelial cells.
21428961 2011 Viruses and the human DEAD-box helicase DDX3: inhibition or exploitation?
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21360055 2011 Translational regulation of HIV-1 replication by HIV-1 Rev cellular cofactors Sam68, eIF5A, hRIP, and DDX3.
21269460 2011 Initial characterization of the human central proteome.
21237216 2011 The role of DDX3 in regulating Snail.
21170385 2010 Hepatitis C virus core protein abrogates the DDX3 function that enhances IPS-1-mediated IFN-beta induction.
20862261 2010 Hepatitis C virus core-derived peptides inhibit genotype 1b viral genome replication via interaction with DDX3X.
20837705 2010 DDX3 regulates cell growth through translational control of cyclin E1.
20657822 2010 Hepatitis B virus polymerase blocks pattern recognition receptor signaling via interaction with DDX3: implications for immune evasion.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20375222 2010 Hepatitis B virus polymerase inhibits RIG-I- and Toll-like receptor 3-mediated beta interferon induction in human hepatocytes through interference with interferon regulatory factor 3 activation and dampening of the interaction between TBK1/IKKepsilon and DDX3.
20127681 2010 DEAD/H BOX 3 (DDX3) helicase binds the RIG-I adaptor IPS-1 to up-regulate IFN-beta-inducing potential.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913487 2009 Structural basis for targeting of human RNA helicase DDX3 by poxvirus protein K7.
19793905 2010 Requirement of cellular DDX3 for hepatitis C virus replication is unrelated to its interaction with the viral core protein.
19782656 2010 Human DEAD-box protein 3 has multiple functions in gene regulation and cell cycle control and is a prime target for viral manipulation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18985028 2008 Hepatitis C virus infection protein network.
18846110 2008 Identification of an antiapoptotic protein complex at death receptors.
18845156 2009 Poxvirus K7 protein adopts a Bcl-2 fold: biochemical mapping of its interactions with human DEAD box RNA helicase DDX3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636090 2008 Viral targeting of DEAD box protein 3 reveals its role in TBK1/IKKepsilon-mediated IRF activation.
18632687 2008 TDRD3, a novel Tudor domain-containing protein, localizes to cytoplasmic stress granules.
18628297 2008 Human DDX3 functions in translation and interacts with the translation initiation factor eIF3.
18596238 2008 The DEAD-box RNA helicase DDX3 associates with export messenger ribonucleoproteins as well as tip-associated protein and participates in translational control.
18583960 2008 The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18264132 2008 Oncogenic role of DDX3 in breast cancer biogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855521 2007 DDX3 DEAD-box RNA helicase is required for hepatitis C virus RNA replication.
17667941 2008 Candidate tumor suppressor DDX3 RNA helicase specifically represses cap-dependent translation by acting as an eIF4E inhibitory protein.
17631897 2007 Crystal structure of conserved domains 1 and 2 of the human DEAD-box helicase DDX3X in complex with the mononucleotide AMP.
17401195 2007 Expression, purification, crystallization and preliminary X-ray diffraction analysis of the DDX3 RNA helicase domain.
17357160 2007 Human DEAD-box ATPase DDX3 shows a relaxed nucleoside substrate specificity.
17095540 2007 Protein composition of human mRNPs spliced in vitro and differential requirements for mRNP protein recruitment.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16818630 2006 DDX3, a DEAD box RNA helicase with tumor growth-suppressive property and transcriptional regulation activity of the p21waf1/cip1 promoter, is a candidate tumor suppressor.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
16301996 2006 DDX3, a DEAD box RNA helicase, is deregulated in hepatitis virus-associated hepatocellular carcinoma and is involved in cell growth control.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15772651 2005 The DNA sequence of the human X chromosome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15588285 2004 Alterations in the expression of DEAD-box and other RNA binding proteins during HIV-1 replication.
15507209 2004 Requirement of DDX3 DEAD box RNA helicase for HIV-1 Rev-RRE export function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14729942 2004 Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11710523 2001 Gene structure of the human DDX3 and chromosome mapping of its related sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10859333 2000 An N-acetylated natural ligand of human histocompatibility leukocyte antigen (HLA)-B39. Classical major histocompatibility complex class I proteins bind peptides with a blocked NH(2) terminus in vivo.
10336476 1999 Hepatitis C virus core protein binds to a DEAD box RNA helicase.
10329544 1999 Hepatitis C virus core protein interacts with a human DEAD box protein DDX3.
10074132 1999 Hepatitis C virus core protein interacts with cellular putative RNA helicase.
9730595 1998 Assignment of a human putative RNA helicase gene, DDX3, to human X chromosome bands p11.3-->p11.23.
9381176 1997 Functional coherence of the human Y chromosome.