Property Summary

Ligand Count 1
NCBI Gene PubMed Count 117
PubMed Score 221.69
PubTator Score 122.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.100 3.3e-02
atypical teratoid / rhabdoid tumor 1.200 7.3e-04
COPD -1.100 4.2e-03
dermatomyositis -1.100 7.9e-03
ependymoma 1.800 5.0e-03
Gaucher disease type 1 -2.000 1.2e-02
group 4 medulloblastoma 1.500 7.9e-04
hereditary spastic paraplegia -1.098 1.9e-02
interstitial lung disease -1.300 4.1e-02
lung adenocarcinoma 1.194 4.5e-05
lung cancer -1.400 8.7e-04
medulloblastoma, large-cell 1.500 1.3e-04
Multiple myeloma 1.842 2.7e-04
oligodendroglioma 1.700 3.4e-03
osteosarcoma 2.005 9.8e-04
ovarian cancer -2.000 2.7e-05
progressive supranuclear palsy -1.200 5.6e-03
psoriasis 1.500 1.3e-04

PDB (11)

Gene RIF (106)

AA Sequence

MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS      1 - 70
SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL     71 - 140
PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA    141 - 210
IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV    211 - 280
QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD    281 - 350
RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV    351 - 420
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG    421 - 490
KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL    491 - 560
VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS    561 - 630
SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN                                          631 - 662
//

Text Mined References (137)

PMID Year Title