Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.82
PubTator Score 33.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma 1.400 1.1e-06
medulloblastoma, large-cell 1.100 8.1e-04
primitive neuroectodermal tumor 1.400 6.7e-04
tuberculosis and treatment for 6 months 1.200 8.9e-06
Breast cancer -1.300 2.4e-24

Gene RIF (5)

PMID Text
25585691 Ddx19 is an RNA export factor required for nuclear import of the SRF coactivator MKL1
22064466 Dbp5, Gle1-IP6 and Nup159: a working model for mRNP export.
19244245 Results describe the crystal structures of human DDX19, a DEXD/H-box protein, in its open and closed cleft conformations.
19219046 Using in vitro assays, the authors demonstrate that NUP214 decreases both the RNA binding and ATPase activities of DBP5.
12219940 identification and characterization of a gene coding a novel isoform

AA Sequence

MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNL      1 - 70
VDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQS     71 - 140
GTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKIS    141 - 210
EQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDS    211 - 280
VWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA    281 - 350
AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN    351 - 420
ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN               421 - 479
//

Text Mined References (22)

PMID Year Title
25585691 2015 RNA export factor Ddx19 is required for nuclear import of the SRF coactivator MKL1.
25416956 2014 A proteome-scale map of the human interactome network.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22064466 Dbp5, Gle1-IP6 and Nup159: a working model for mRNP export.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19244245 2009 The DEXD/H-box RNA helicase DDX19 is regulated by an {alpha}-helical switch.
19219046 2009 The mRNA export protein DBP5 binds RNA and the cytoplasmic nucleoporin NUP214 in a mutually exclusive manner.
19208808 2009 Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12219940 2002 Identification and characterization of a gene coding a novel isoform of DEAD-box protein.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10428971 1999 Dbp5, a DEAD-box protein required for mRNA export, is recruited to the cytoplasmic fibrils of nuclear pore complex via a conserved interaction with CAN/Nup159p.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1424986 1992 A cDNA clone for a novel nuclear protein with DNA binding activity.