Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.07
PubTator Score 6.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 8.9e-05
Multiple myeloma 1327 2.2e-03
astrocytic glioma 2241 2.6e-02
Disease Target Count Z-score Confidence
Hepatitis C 90 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.242 2.2e-03
astrocytic glioma -1.200 2.6e-02
psoriasis 1.600 8.9e-05

Gene RIF (2)

PMID Text
23675531 DDRGK1 regulates NF-kappaB activity by modulating IkappaBalpha stability.
20228063 found that C53/LZAP and DDRGK1 became more susceptible to the proteasome-mediated degradation in RCAD knockdown cells, whereas their ubiquitination was significantly attenuated by RCAD overexpression

AA Sequence

MVAPVWYLVAAALLVGFILFLTRSRGRAASAGQEPLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDL      1 - 70
GSRLQAQRRAQRVAWAEADENEEEAVILAQEEEGVEKPAETHLSGKIGAKKLRKLEEKQARKAQREAEEA     71 - 140
EREERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKLKEAFVVEEEGVGETMTEE    141 - 210
QSQSFLTEFINYIKQSKVVLLEDLASQVGLRTQDTINRIQDLLAEGTITGVIDDRGKFIYITPEELAAVA    211 - 280
NFIRQRGRVSIAELAQASNSLIAWGRESPAQAPA                                        281 - 314
//

Text Mined References (20)

PMID Year Title
26544067 2015 UFBP1, a Key Component of the Ufm1 Conjugation System, Is Essential for Ufmylation-Mediated Regulation of Erythroid Development.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23675531 2013 DDRGK1 regulates NF-?B activity by modulating I?B? stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21659334 2011 Genome-wide association study identified ITPA/DDRGK1 variants reflecting thrombocytopenia in pegylated interferon and ribavirin therapy for chronic hepatitis C.
21494687 2011 Ubiquitin fold modifier 1 (UFM1) and its target UFBP1 protect pancreatic beta cells from ER stress-induced apoptosis.
21269460 2011 Initial characterization of the human central proteome.
20637204 2010 ITPA polymorphism affects ribavirin-induced anemia and outcomes of therapy--a genome-wide study of Japanese HCV virus patients.
20228063 2010 A novel C53/LZAP-interacting protein regulates stability of C53/LZAP and DDRGK domain-containing Protein 1 (DDRGK1) and modulates NF-kappaB signaling.
20036718 2010 Cloning and molecular characterization of Dashurin encoded by C20orf116, a PCI-domain containing protein.
20018847 2010 A novel type of E3 ligase for the Ufm1 conjugation system.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.