Property Summary

NCBI Gene PubMed Count 137
PubMed Score 0.00
PubTator Score 151.05

Knowledge Summary

Patent (14,880)

TINX Plot

  Disease (6)

Disease Target Count
Schizophrenia 1136
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
lung cancer 4607 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2388 3.821 1.9
Vitiligo 71 3.299 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.400 1.9e-04
astrocytic glioma 1.700 3.2e-03
Astrocytoma, Pilocytic 1.600 9.0e-09
atypical teratoid / rhabdoid tumor 1.300 1.9e-05
Down syndrome 1.100 9.2e-04
ductal carcinoma in situ 1.500 2.8e-03
ependymoma 1.700 7.0e-03
glioblastoma 1.100 5.6e-07
interstitial cystitis -1.300 1.9e-03
invasive ductal carcinoma 1.500 4.4e-02
lung adenocarcinoma 1.234 1.0e-06
medulloblastoma, large-cell -2.000 5.1e-04
non-small cell lung cancer 1.430 3.8e-14
oligodendroglioma 2.000 1.5e-03
ovarian cancer 1.700 9.1e-05
pancreatic ductal adenocarcinoma liver m... 1.476 2.0e-02
primitive neuroectodermal tumor 1.100 4.2e-03

Gene RIF (100)

AA Sequence

MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD      1 - 70
GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV     71 - 140
ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL    141 - 210
NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF    211 - 280
QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF    281 - 350
LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI    351 - 420
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR    421 - 490
GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP    491 - 560
PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD    561 - 630
SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI    631 - 700
TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR    701 - 770
NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC    771 - 840
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL    841 - 910
NTV                                                                       911 - 913
//

Text Mined References (146)

PMID Year Title