Property Summary

NCBI Gene PubMed Count 19
PubMed Score 105.82
PubTator Score 25.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1136
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
Pilocytic astrocytoma 1.100 2.6e-05
posterior fossa group B ependymoma 1.300 1.6e-06
psoriasis -1.400 6.7e-26
subependymal giant cell astrocytoma 1.094 1.5e-02

Gene RIF (7)

AA Sequence

MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRE      1 - 70
TFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLK     71 - 140
CECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPW    141 - 210
VEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPY    211 - 280
RPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL             281 - 341
//

Text Mined References (21)

PMID Year Title