Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.55
PubTator Score 16.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
SPASTIC PARAPLEGIA 54, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.800 2.5e-05
Amyotrophic lateral sclerosis 1.050 5.0e-05
astrocytic glioma -1.400 1.2e-02
Astrocytoma, Pilocytic -1.400 1.9e-06
glioblastoma -1.500 1.8e-07
group 4 medulloblastoma -1.200 1.0e-03
medulloblastoma, large-cell -1.600 2.1e-03
oligodendroglioma -1.100 3.8e-02
ovarian cancer -2.300 1.9e-06
Waldenstrons macroglobulinemia -1.351 7.3e-03

Gene RIF (10)

AA Sequence

MSSVQSQQEQLSQSDPSPSPNSCSSFELIDMDAGSLYEPVSPHWFYCKIIDSKETWIPFNSEDSQQLEEA      1 - 70
YSSGKGCNGRVVPTDGGRYDVHLGERMRYAVYWDELASEVRRCTWFYKGDKDNKYVPYSESFSQVLEETY     71 - 140
MLAVTLDEWKKKLESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQGRPRTVKRGVENISVDIHCGEP    141 - 210
LQIDHLVFVVHGIGPACDLRFRSIVQCVNDFRSVSLNLLQTHFKKAQENQQIGRVEFLPVNWHSPLHSTG    211 - 280
VDVDLQRITLPSINRLRHFTNDTILDVFFYNSPTYCQTIVDTVASEMNRIYTLFLQRNPDFKGGVSIAGH    281 - 350
SLGSLILFDILTNQKDSLGDIDSEKDSLNIVMDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCT    351 - 420
DRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSV    421 - 490
KYPRLIYKPEIFFAFGSPIGMFLTVRGLKRIDPNYRFPTCKGFFNIYHPFDPVAYRIEPMVVPGVEFEPM    491 - 560
LIPHHKGRKRMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQASETPEETEAEPESTSEKPS    561 - 630
DVNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQ    631 - 700
TQGIFLDQPLQ                                                               701 - 711
//

Text Mined References (25)

PMID Year Title