Property Summary

NCBI Gene PubMed Count 22
PubMed Score 89.54
PubTator Score 35.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.8e-08
lung cancer 4473 2.4e-03
Disease Target Count Z-score Confidence
Fanconi's anemia 50 4.723 2.4

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.100 3.8e-08
lung cancer 1.200 2.4e-03

Gene RIF (11)

PMID Text
26582912 Different charge distributions along the DNA binding groove may account for the drastic difference in processivity and DNA digestion efficiency, including that of damaged substrates, between SNM1A and SNM1B.
22692201 differences in the substrate selectivities of SNM1A and SNM1B are likely to be relevant to their in vivo roles
21896658 collaboration between hSNM1A and XPF-ERCC1 is necessary to initiate interstrand cross-link repair in replicating human cells
20385554 RAD18-dependent recruitment of SNM1A to DNA repair complexes by a ubiquitin-binding zinc finger
18848520 These findings suggest that SNM1A acts with ATM to promote the G1 cell cycle checkpoint.
18180189 hSNM1 appears to represent a second pathway for genome stability
18006388 Human SNM1A suppresses the DNA repair defects of yeast pso2 mutants.
17804464 The SNM1 enzyme utilizes either DNA or RNA substrates, requires a 5'-phosphate moiety, shows very little activity on double-strand substrates, and functions at a size consistent with a monomer.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15542852 Snm1 and 53BP1 are components of a mitotic stress checkpoint that negatively targets the APC prior to chromosome condensation
12446782 Results suggest that 53BP1 and Snm1 may cooperate in the cellular response to genotoxic damage.

AA Sequence

MLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNRKRAAEAKEVKDHEVPLGNA      1 - 70
GCQTSVASSQNSSCGDGIQQTQDKETTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWH     71 - 140
VFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAGDHPFSSPSPASGGSFSETKSGVLCSLE    141 - 210
ERWSSYQNQTDNSVSNDPLLMTQYFKKSPSLTEASEKISTHIQTSQQALQFTDFVENDKLVGVALRLANN    211 - 280
SEHINLPLPENDFSDCEISYSPLQSDEDTHDIDEKPDDSQEQLFFTESSKDGSLEEDDDSCGFFKKRHGP    281 - 350
LLKDQDESCPKVNSFLTRDKYDEGLYRFNSLNDLSQPISQNNESTLPYDLACTGGDFVLFPPALAGKLAA    351 - 420
SVHQATKAKPDEPEFHSAQSNKQKQVIEESSVYNQVSLPLVKSLMLKPFESQVEGYLSSQPTQNTIRKLS    421 - 490
SENLNAKNNTNSACFCRKALEGVPVGKATILNTENLSSTPAPKYLKILPSGLKYNARHPSTKVMKQMDIG    491 - 560
VYFGLPPKRKEEKLLGESALEGINLNPVPSPNQKRSSQCKRKAEKSLSDLEFDASTLHESQLSVELSSER    561 - 630
SQRQKKRCRKSNSLQEGACQKRSDHLINTESEAVNLSKVKVFTKSAHGGLQRGNKKIPESSNVGGSRKKT    631 - 700
CPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAGLSKHFTFPVYCSEITGNLLKNKLHVQEQYI    701 - 770
HPLPLDTECIVNGVKVVLLDANHCPGAVMILFYLPNGTVILHTGDFRADPSMERSLLADQKVHMLYLDTT    771 - 840
YCSPEYTFPSQQEVIRFAINTAFEAVTLNPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQC    841 - 910
LNIPEINSLITTDMCSSLVHLLPMMQINFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQT    911 - 980
KGNISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTWKSRSTMEKYFREWKLEAGY              981 - 1040
//

Text Mined References (26)

PMID Year Title
26582912 2015 The structures of the SNM1A and SNM1B/Apollo nuclease domains reveal a potential basis for their distinct DNA processing activities.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22692201 2012 Characterization of the human SNM1A and SNM1B/Apollo DNA repair exonucleases.
21896658 2011 Human SNM1A and XPF-ERCC1 collaborate to initiate DNA interstrand cross-link repair.
20528238 2010 The multifunctional SNM1 gene family: not just nucleases.
20385554 2010 RAD18-dependent recruitment of SNM1A to DNA repair complexes by a ubiquitin-binding zinc finger.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18848520 2008 SNM1A acts downstream of ATM to promote the G1 cell cycle checkpoint.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18180189 2008 Mammalian SNM1 is required for genome stability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006388 2008 Human SNM1A suppresses the DNA repair defects of yeast pso2 mutants.
17804464 2007 The hSNM1 protein is a DNA 5'-exonuclease.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15572677 2004 DNA cross-link repair protein SNM1A interacts with PIAS1 in nuclear focus formation.
15542852 2004 Deficiency in SNM1 abolishes an early mitotic checkpoint induced by spindle stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12509242 2002 Translation of hSNM1 is mediated by an internal ribosome entry site that upregulates expression during mitosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446782 2002 hSnm1 colocalizes and physically associates with 53BP1 before and after DNA damage.
10848582 2000 Disruption of mouse SNM1 causes increased sensitivity to the DNA interstrand cross-linking agent mitomycin C.
9806498 1998 Genomic organization of a potential human DNA-crosslink repair gene, KIAA0086.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.