Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.89
PubTator Score 2.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
Aniridia 26 4.573 2.3
Dyslexia 36 3.142 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 1.1e-13
osteosarcoma -1.090 3.7e-02
sonic hedgehog group medulloblastoma 2.900 1.4e-04
lung adenocarcinoma -1.200 2.7e-08
nasopharyngeal carcinoma -1.500 7.4e-05
lung carcinoma -1.100 5.1e-03
chronic rhinosinusitis -1.986 2.3e-02

Gene RIF (1)

PMID Text
12820024 DCDC1 was mapped to 11p13; mainly expressed in adult testis; and its expression in fetal brain was much higher than in adult brain

AA Sequence

MAKTGAEDHREALSQSSLSLLTEAMEVLQQSSPEGTLDGNTVNPIYKYILNDLPREFMSSQAKAVIKTTD      1 - 70
DYLQSQFGPNRLVHSAAVSEGSGLQDCSTHQTASDHSHDEISDLDSYKSNSKNNSCSISASKRNRPVSAP     71 - 140
VGQLRVAEFSSLKFQSARNWQKLSQRHKLQPRVIKVTAYKNGSRTVFARVTVPTITLLLEECTEKLNLNM    141 - 210
AARRVFLADGKEALEPEDIPHEADVYVSTGEPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKP    211 - 280
VLSIRMKKLTERTSVRILFFKNGMGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDIS    281 - 350
KGKH                                                                      351 - 354
//

Text Mined References (8)

PMID Year Title
21321669 2011 A 556 kb deletion in the downstream region of the PAX6 gene causes familial aniridia and other eye anomalies in a Chinese family.
20236041 2010 The doublecortin gene family and disorders of neuronal structure.
19801982 2009 Twenty bone-mineral-density loci identified by large-scale meta-analysis of genome-wide association studies.
16869982 2006 The evolving doublecortin (DCX) superfamily.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820024 2003 Identification of a novel human doublecortin-domain-containing gene (DCDC1) expressed mainly in testis.