Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.49
PubTator Score 13.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Y chromosome deletions 7
Disease Target Count Z-score Confidence
Azoospermia 89 4.551 2.3
Disease Target Count
Spermatogenic failure Y-linked 2 5

Gene RIF (10)

PMID Text
26232607 Studies indicate that partial RNA-binding proteins DAZ1/2 deletion was associated wih male infertility, but partial RNA-binding proteins DAZ3/4 deletion was not associated with male infertility.
24878370 Deletion of DAZ2 and DAZ4 gene copies is associated with male infertility.
23512232 There appears to be an asociation of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
19223287 All four DAZ genes are expressed in the human testis, and their products are highly polymorphic among men
17416365 AZFc subdeletions do not seem to cause severe impairment of spermatogenesis in Chilean men.
16963411 Observational study of gene-disease association. (HuGE Navigator)
16674553 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16580401 Observational study of gene-disease association. (HuGE Navigator)
16491269 Observational study of genotype prevalence. (HuGE Navigator)
11883873 DAZ gene copy number in severely idiopathic infertile men. Gene deletion of two copies of DAZ (DAZI and 2) was the cause of spermatogenic damage.

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK      1 - 70
IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQ     71 - 140
NVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPV    141 - 210
YNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQL    211 - 280
PVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPVQVTTGY    281 - 350
QLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTT    351 - 420
GYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQV    421 - 490
TTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD      491 - 558
//

Text Mined References (34)

PMID Year Title
26232607 2015 Impact of partial DAZ1/2 deletion and partial DAZ3/4 deletion on male infertility.
24878370 2014 Combined deletion of DAZ2 and DAZ4 copies of Y chromosome DAZ gene is associated with male infertility in Tunisian men.
23512232 2013 Association of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
19223287 2009 Polymorphic expression of DAZ proteins in the human testis.
17416365 2007 AZFc partial deletions in Chilean men with severe spermatogenic failure.
16963411 2006 [Study on DAZ gene copy deletion in severe oligozoospermia sperm donor for ICSI].
16674553 2006 A frequent partial AZFc deletion does not render an increased risk of spermatogenic impairment in East Asians.
16580401 2006 Preliminary study of the relationship between DAZ gene copy deletions and spermatogenic impairment in Chinese men.
16491269 2006 DAZ1/DAZ2 cluster deletion mediated by gr/gr recombination per se may not be sufficient for spermatogenesis impairment: a study of Chinese normozoospermic men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15066460 2004 Expression profiles of the DAZ gene family in human testis with and without spermatogenic failure.
15066457 2004 Analysis of the DAZ gene family in cryptorchidism and idiopathic male infertility.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12801575 2003 Partial DAZ deletions in a family with five infertile brothers.
12752250 2003 Polymorphic DAZ gene family in polymorphic structure of AZFc locus: Artwork or functional for human spermatogenesis?
12511597 2003 Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11883873 2002 A novel approach for the analysis of DAZ gene copy number in severely idiopathic infertile men.
11870237 2002 High frequency of DAZ1/DAZ2 gene deletions in patients with severe oligozoospermia.
11869379 2002 A preliminary report on the implication of RT-PCR detection of DAZ, RBMY1, USP9Y and Protamine-2 mRNA in testicular biopsy samples from azoospermic men.
11694340 2001 Male infertility, genetic analysis of the DAZ genes on the human Y chromosome and genetic analysis of DNA repair.
11688365 [Microdeletion of chromosome Y in male infertility: role of the DAZ gene].
11390979 2001 A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans.
11095434 2000 Male infertility caused by a de novo partial deletion of the DAZ cluster on the Y chromosome.
11058556 2000 DAZ family proteins exist throughout male germ cell development and transit from nucleus to cytoplasm at meiosis in humans and mice.
10936047 2000 Four DAZ genes in two clusters found in the AZFc region of the human Y chromosome.
10903443 2000 In vivo and in vitro analysis of homodimerisation activity of the mouse Dazl1 protein.
10857750 2000 Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.
9700189 1998 Evolution of the DAZ gene family suggests that Y-linked DAZ plays little, or a limited, role in spermatogenesis but underlines a recent African origin for human populations.
9557839 1998 DAZ (Deleted in AZoospermia) genes encode proteins located in human late spermatids and in sperm tails.
9321470 1997 The human DAZ genes, a putative male infertility factor on the Y chromosome, are highly polymorphic in the DAZ repeat regions.
8968756 1996 The human autosomal gene DAZLA: testis specificity and a candidate for male infertility.
8896558 1996 The DAZ gene cluster on the human Y chromosome arose from an autosomal gene that was transposed, repeatedly amplified and pruned.
7670487 1995 Diverse spermatogenic defects in humans caused by Y chromosome deletions encompassing a novel RNA-binding protein gene.