Property Summary

NCBI Gene PubMed Count 28
PubMed Score 27.03
PubTator Score 29.12

Knowledge Summary

Patent (7,449)

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -3.180 2.8e-09
non-small cell lung cancer -2.031 1.0e-25
lung cancer -3.700 2.1e-06
breast carcinoma -1.200 8.1e-05
fibroadenoma -1.200 3.9e-02
cystic fibrosis -1.200 5.2e-05
lung adenocarcinoma -2.300 7.2e-15
lung carcinoma -1.700 3.1e-23
ductal carcinoma in situ -1.400 5.6e-03
invasive ductal carcinoma -1.700 1.4e-03
ulcerative colitis -1.200 2.8e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
26483415 that Death-associated protein kinase 2 effector functions are influenced by the protein's subcellular localization
26047703 DAPK2-induced apoptosis is negatively regulated by Akt and 14-3-3 proteins.
26038578 This study links adipocyte expression of an autophagy-regulating kinase, lysosome-mediated clearance and fat cell lipid accumulation; it demonstrates obesity-related attenuated autophagy in adipocytes, and identifies DAPK2 dependence in this regulation.
25982274 miR-520h suppresses Death-associated protein kinase 2 (DAPK2) expression, as restoring DAPK2 abolished miR-520h-promoted drug resistance, and knockdown of DAPK2 mitigated cell death caused by the depletion of miR-520h.
25741596 DAPK2 regulates oxidative stress in cancer cells by preserving mitochondrial function
25361081 DAPK2 is a novel kinase of mTORC1 and is a potential new member of this multiprotein complex, modulating mTORC1 activity and autophagy levels under stress and steady-state conditions.
24163421 The defect in chemotaxis in DAPK2-inactive granulocytes is likely a result of reduced polarization of the cells, mediated by a lack of MLC phosphorylation, resulting in radial F-actin and pseudopod formation.
24038216 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL.
23700042 DAPK2 is upregulated in uterosacral ligaments in pelvic organ prolapse
22160140 Sodium butyrate induced DAPK1/2 expression in human gastric cancer cells and this expression prompted apoptosis by decreasing FAK levels.
21408167 DRP-1 and ZIPk most likely evolved from their ancient ancestor gene DAPk by two gene duplication events that occurred close to the emergence of vertebrates
19221469 Results showed that the inactivation of RASSF1A, RARbeta2 and DAP-Kinase by hypermethylation is a key step in NPC tumorigenesis and progression.
18976975 Knockdown of death-associated protein kinase 2 (DAPK2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18957423 beta-catenin-induced down-regulation of DAPk-2 represents a novel signaling mechanism by which beta-catenin promotes the survival of malignant epithelial cells
18521079 DAPK2 as a novel Sp1-dependent target gene for E2F1 and KLF6 in cell death response.
17347302 Results implicate a novel role for DAPK2 in the regulation of normal myelopoiesis.
12087472 gene expression in colorectal and gastric cancer silenced by DNA methylation and histone deacetylation
11839665 distinct methylation pattern in bladder cancer with frequent methylation of RARbeta, DAPK, E-cadherin, and p16.
11839660 High frequency of promoter hypermethylation of the death-associated protein-kinase gene in nasopharyngeal carcinoma and its detection in the peripheral blood of patients

AA Sequence

MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREE      1 - 70
IEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYL     71 - 140
HTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADM    141 - 210
WSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEAL    211 - 280
RHPWITPVDNQQAMVRRESVVNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESD    281 - 350
TEEDIARRKALHPRRRSSTS                                                      351 - 370
//

Text Mined References (33)

PMID Year Title
26483415 2016 Identification of Novel Death-Associated Protein Kinase 2 Interaction Partners by Proteomic Screening Coupled with Bimolecular Fluorescence Complementation.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
26038578 2015 DAPK2 Downregulation Associates With Attenuated Adipocyte Autophagic Clearance in Human Obesity.
25982274 2016 miR-520h is crucial for DAPK2 regulation and breast cancer progression.
25741596 2015 DAPK2 regulates oxidative stress in cancer cells by preserving mitochondrial function.
25416956 2014 A proteome-scale map of the human interactome network.
25361081 2015 DAPK2 is a novel regulator of mTORC1 activity and autophagy.
24163421 2014 DAPK2 positively regulates motility of neutrophils and eosinophils in response to intermediary chemoattractants.
24038216 2014 The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBP? during granulocytic differentiation but repressed by PML-RAR? in APL.
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22160140 2012 Sodium butyrate-induced DAPK-mediated apoptosis in human gastric cancer cells.
21408167 2011 New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.
19221469 2009 Inactivation of RASSF1A, RARbeta2 and DAP-kinase by promoter methylation correlates with lymph node metastasis in nasopharyngeal carcinoma.
18957423 2009 Down-regulation of death-associated protein kinase-2 is required for beta-catenin-induced anoikis resistance of malignant epithelial cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18521079 2008 DAPK2 is a novel E2F1/KLF6 target gene involved in their proapoptotic function.
17347302 2007 The death-associated protein kinase 2 is up-regulated during normal myeloid differentiation and enhances neutrophil maturation in myeloid leukemic cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16756490 2006 The death-associated protein kinases: structure, function, and beyond.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445458 2002 The DAP-kinase family of proteins: study of a novel group of calcium-regulated death-promoting kinases.
12087472 2002 DNA methylation and histone deacetylation associated with silencing DAP kinase gene expression in colorectal and gastric cancers.
11980920 2002 DAP kinase and DRP-1 mediate membrane blebbing and the formation of autophagic vesicles during programmed cell death.
11839665 2002 Hypermethylation of multiple genes in tumor tissues and voided urine in urinary bladder cancer patients.
11230133 2001 Autophosphorylation restrains the apoptotic activity of DRP-1 kinase by controlling dimerization and calmodulin binding.
10629061 2000 Death-associated protein kinase-related protein 1, a novel serine/threonine kinase involved in apoptosis.
10376525 1999 Death-associated protein kinase 2 is a new calcium/calmodulin-dependent protein kinase that signals apoptosis through its catalytic activity.