Property Summary

NCBI Gene PubMed Count 209
PubMed Score 226.07
PubTator Score 307.56

Knowledge Summary

Patent (11,312)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.2
Kidney cancer 2548 0.0 0.8
Disease Target Count Z-score Confidence
Cognitive disorder 48 0.0 1.7
pancreatic cancer 2322 0.0 1.7
Disease Target Count Z-score Confidence
Cancer 2388 4.989 2.5

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.300 2.3e-02
Astrocytoma, Pilocytic -1.800 5.0e-06
atypical teratoid / rhabdoid tumor -1.400 1.6e-03
COPD -1.200 1.9e-02
cystic fibrosis -1.642 1.3e-06
ependymoma 1.200 1.9e-02
glioblastoma -1.200 5.9e-03
group 4 medulloblastoma 1.200 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.700 6.1e-04
invasive ductal carcinoma 1.649 1.5e-05
lung cancer -4.800 2.9e-06
medulloblastoma, large-cell -1.100 2.8e-02
non-small cell lung cancer -1.955 1.0e-17
oligodendroglioma 1.100 2.1e-02
ovarian cancer -4.600 8.3e-20
pediatric high grade glioma -1.100 1.7e-03
psoriasis -1.200 1.3e-02
tuberculosis and treatment for 6 months -1.400 9.2e-03
X-linked cerebral adrenoleukodystrophy -2.600 1.4e-02

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (189)

AA Sequence

MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKE      1 - 70
IQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDL     71 - 140
KPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL    141 - 210
LSGASPFLGDTKQETLANVSAVNYEFEDEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDT    211 - 280
QQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH    281 - 350
AINDDNVPGLQHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAA    351 - 420
RHGHVDTLKFLSENKCPLDVKDKSGEMALHVAARYGHADVAQLLCSFGSNPNIQDKEEETPLHCAAWHGY    421 - 490
YSVAKALCEAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNACDKDGHIALHLAVRRCQMEVI    491 - 560
KTLLSQGCFVDYQDRHGNTPLHVACKDGNMPIVVALCEANCNLDISNKYGRTPLHLAANNGILDVVRYLC    561 - 630
LMGASVEALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGK    631 - 700
TTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLT    701 - 770
KGMLEVFVAPTHHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVF    771 - 840
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVATHADIMNVPRPAGGEFGYDKDTSL    841 - 910
LKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCPPMTHLCEKIISTLPSWRKLN    911 - 980
GPNQLMSLQQFVYDVQDQLNPLASEEDLRRIAQQLHSTGEINIMQSETVQDVLLLDPRWLCTNVLGKLLS    981 - 1050
VETPRALHHYRGRYTVEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDVPALIKTDNLHRSWADEE   1051 - 1120
DEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGCKLANRGAELLVLLVNH   1121 - 1190
GQGIEVQVRGLETEKIKCCLLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA   1191 - 1260
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLL   1261 - 1330
AMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKASSVFK   1331 - 1400
INLDGNGQEAYASSCNSGTSYNSISSVVSR                                           1401 - 1430
//

Text Mined References (224)

PMID Year Title