Property Summary

NCBI Gene PubMed Count 38
PubMed Score 22.56
PubTator Score 39.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.713 1.6e-04
glioblastoma 1.300 4.4e-04
medulloblastoma, large-cell 1.100 8.3e-04
pancreatic ductal adenocarcinoma liver m... 1.274 5.6e-03
intraductal papillary-mucinous carcinoma... 1.300 5.6e-04
lung cancer 1.400 4.4e-04
group 3 medulloblastoma 1.400 1.3e-04
subependymal giant cell astrocytoma 1.034 4.9e-02
ovarian cancer 2.400 5.4e-06

Gene RIF (20)

PMID Text
26306039 DAP3 plays important roles in mitochondrial function and dynamics
25738636 DAP3 silencing contributes to breast carcinogenesis.
24300973 Knockdown of DAP3 expression promoted cell migration.
22287761 Study demonstrates an inverse association between DAP3 mRNA levels and tumour stage and clinical outcome in breast cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20563667 identified a novel DAP3-binding protein termed death ligand signal enhancer (DELE); results demonstrated the biological significance of DELE for apoptosis signal mediated by death receptors
19644511 show that interferon-beta promoter stimulator 1 (IPS-1) binds DAP3 and induces anoikis by caspase activation.
19536094 DAP3 may participate in mitochondrial maintenance and play a role in the balance between mitochondrial homoeostasis and tumourigenesis in thyroid oncocytic tumors.
19103604 Complex I and DAP3, hNOA1 may play a role in mitochondrial respiration and apoptosis.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of death associated protein 3 (DAP3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18227431 study investigated the phosphorylation status of ribosomal DAP3 and mapped the phosphorylation sites by tandem mass spectrometry
17613536 B4GALT3, DAP3, RGS16, TMEM183A and UCK2--were significantly overexpressed in dup(1q)-positive ALLs compared with high hyperdiploid ALLs without dup(1q).
15679048 High DAP3 expression is correlated with thymoma stage
15302871 DAP3 has a role in anoikis signaling and in apoptosis induction caused by cell detachment
15179560 Observational study of gene-disease association. (HuGE Navigator)
15179560 DAP3 gene might be associated with the mechanisms responsible for adult bronchial asthma and contribute to airway inflammation and remodeling
15175341 DAP3 has a role in the molecular pathway that culminates in fragmented mitochondria
12359235 not involved in TRAIL-induced apoptosis
12099703 Functional interaction between the pro-apoptotic DAP3 and the glucocorticoid receptor

AA Sequence

MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNI      1 - 70
SPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCH     71 - 140
VIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVW    141 - 210
NKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKS    211 - 280
PIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP    281 - 350
KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL                          351 - 398
//

Text Mined References (43)

PMID Year Title
26306039 2015 Death-associated Protein 3 Regulates Mitochondrial-encoded Protein Synthesis and Mitochondrial Dynamics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25738636 2015 Effects of the knockdown of death-associated protein 3 expression on cell adhesion, growth and migration in breast cancer cells.
24300973 2014 Death-associated protein-3, DAP-3, correlates with preoperative chemotherapy effectiveness and prognosis of gastric cancer patients following perioperative chemotherapy and radical gastrectomy.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22287761 2012 The mRNA expression of DAP3 in human breast cancer: correlation with clinicopathological parameters.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20563667 2010 Identification of DELE, a novel DAP3-binding protein which is crucial for death receptor-mediated apoptosis induction.
20079882 2010 Regulation of mitochondrial ribosomal protein S29 (MRPS29) expression by a 5'-upstream open reading frame.
19644511 2009 IPS-1 is crucial for DAP3-mediated anoikis induction by caspase-8 activation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19536094 2009 Death-associated protein 3 is overexpressed in human thyroid oncocytic tumours.
19103604 2009 hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18227431 2008 Identification of phosphorylation sites in mammalian mitochondrial ribosomal protein DAP3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17613536 2007 Tiling resolution array comparative genomic hybridization, expression and methylation analyses of dup(1q) in Burkitt lymphomas and pediatric high hyperdiploid acute lymphoblastic leukemias reveal clustered near-centromeric breakpoints and overexpression of genes in 1q22-32.3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15679048 2004 Arg and DAP3 expression was correlated with human thymoma stage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302871 2004 Functional role of death-associated protein 3 (DAP3) in anoikis.
15179560 2004 Association between genetic variation in the gene for death-associated protein-3 (DAP3) and adult asthma.
15175341 2004 Death-associated protein 3 localizes to the mitochondria and is involved in the process of mitochondrial fragmentation during cell death.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359235 2002 TRAIL-induced apoptosis is independent of the mitochondrial apoptosis mediator DAP3.
12099703 2002 Functional interaction between the pro-apoptotic DAP3 and the glucocorticoid receptor.
11753396 2002 Interaction of DAP3 and FADD only after cellular disruption.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11402041 2001 Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28 S small subunit.
11376335 2001 A GTP-binding adapter protein couples TRAIL receptors to apoptosis-inducing proteins.
11279123 2001 The small subunit of the mammalian mitochondrial ribosome. Identification of the full complement of ribosomal proteins present.
11248257 2001 A new face on apoptosis: death-associated protein 3 and PDCD9 are mitochondrial ribosomal proteins.
11162496 2001 A conserved N-terminal sequence targets human DAP3 to mitochondria.
10903152 2000 The pro-apoptotic protein death-associated protein 3 (DAP3) interacts with the glucocorticoid receptor and affects the receptor function.
9284927 1997 Assignment of death associated protein 3 (DAP3) to human chromosome 1q21 by in situ hybridization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7499268 1995 Isolation of DAP3, a novel mediator of interferon-gamma-induced cell death.